PRGDB00077862 (Ta.47059)

From PRG Wiki
Jump to: navigation, search
Ta.47059
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90110668 (DQ205351)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum disease resistance protein mRNA, complete cds

DNA Sequence

AAGAGACGAGAGCATAGCCAAGCCGGCGTCGACACAGCTGGTGGATGAAGAAAGGCAACCACAAGATCTATGATCTCAGCGGCGCACTAACTCAAGTACTGGAGAAGACAGGACGTGTCTTCCTCACGTTGTAGTCAAAGCTAAAGGGTGGTTCTGCAAGAAACACTGTGTTACACAAGCCATTCATTCTCGCGGATCCTGATCAAGCAACGGAGCCGAGCCTAGAAACAATATGGCTGAGTCAGCTGTGAGAACCGTGCTTGGGAGCGTGGGCAACCTTGCAGTCCAGGAGACCACATTCTTGTGTGCAGTCAACCTTGAAGTGGGGTTGTTGAAAGATGAACTGATGAGGTTGCAGGCCTACCTCAAAGATGTTGATTGCAAGTGGAGATCAGGAAATGCAAGGGTTGCAGTCTTGGTGAGCCAGATCAGGGCTGCGGCTTATGAAGCTCAGAATGTCGTTGAAGCTGCAGATCACATGGAGAAGAGAATTAGGCTCAAGAAGGGATTCATGGGTGCTATTTCAAGGTATGCTCGCCTACCGACTGACTTGGTCACCCTTCGTAAAATCGGTGTTGAAATTCAATATGTAAGAAGGAAGCTAAATGAGATTTTTGCAAGTGCGGATCATCTAAAAATTGAATTGGATAATATTGTTGTTGTCGAGGATGAGTTTCTACGAGATTGTGGCCCTATGAATGGAAACTTTGAAGATGATGCCGTCATGGTCGGTTTTGAGGACGAGCACAAAGAATTAGCAAATAAATTAGTTTCCGGAGAACAAATGCTTAGTGTTGTGTCTATAGTTGCCATGGGCGGGGCAGGAAAAACAACGCTTGCTAGAAAAGTCTACACTTCATCTAGAGTCAAAGAGCACTTTGACACACTTGCTTGGGTGACTGTATCTCAAAAGTTTAAGGGCATTGATCTGCTAAAGGATATCATGAAACAAATAACAGGGCACAAAGATGAGTCAGTTAACCAAATGGCGGAGTATAAGGTGGGAAAGAAGATCAATGAATTTCTTTTAGAAAATAAATACTTGGTTGTCCTCGATGATGTTTGGGAAACAGATACATGGGTGCAATTAAACAGAATGATTACAGTTTTTCCAGATGCAACTAATGGTAGTAGAGTACTGTTAACCACACGAAAAGAAGATGTTGCAAACCATATTCAAATGCCAACCCATGTTCATCCTTTGAAGAAATTAGATGAAGAGAAAAGTTGGCAACTTTTTAGTAGCAAAGCTTTACCAACATACAAAAGGTCTGCCATACTTGATGTTGACGAGTTTGAAAAGCTTGGGAGAAAGCTTGCAAAGAAATGTGATGGATTGCCACTAGCGTTGAGAGTTTTGGGAGGTTATCTGTCTAAAAATCTAAATGCACAAATATGGTCCGATATACTCACTGATTGGCCAGCAACCAAGGATGGACAAATAATGAGTGTCATACTGGCACGCAGTTACAAGGACCTACCAAATCATCATTTGAGATCTTGTTTACTTTATTTTGCTGCTTTTCCGGAGGATTATGAAATATATGTGACGCATCTTATTGAGTTGTGGATAGCGGAAAGTTTCATTCCACATACACCAAACCATACACTAGAAGAAACAGCACGGAGCTATGTAACCGAGTTGGCTCAGAGAAGCTTGGTCCAAGTTGTTCGCAGAAGTACGGCGTATGGATGGATAGAGAGAATAAGGATTCACGATATCTTGCATGACTGGTGCATACAAGAAGCAAGACAAGATGGTTTTCTTGATACCAGCAACAAAACTGCAGGCCAAGCTGGTGcatcatcatcatcatcTGATAACTTGATATGTTATCGTTTTAGTTTTCAAACATTGAGTGATCAGATTTTACCTGCAACACCTAATGTCCGAAGTCTGCTTGGCTTTGAGCTTGAGTCAGTGTCCCTTCCTAAGCTGAGATTCCTGAGAGTTCTTTGCATTGAAAACTCAACACTAAAAGATTTCTCCAGTGTAATTGGTGGGTGCATTCACCTGTTGCTGGCGTATATGCCCTATAATCCTGAAGAAGATGACATCACACAAAAGGAGCTGCGGCAGAAAGGATGCAAGGTGGAAAATAGGTGGGACCTTCCATGACATGGATGACAACCTCTCTCTCCTCCAATGTCCCCTCGCTCCTCCGTCCAGATCCGCCATGCCGATGCCAATCTCACCGCCTCCTCATCTTCCGGTGCAGTCGGCCGTCATGAGATTGAGCTGAGGTGGTCTAGGAGAGCCACTGCACAACGCCGACCTTCATTCCCGGTGCCAAGGTCGCCGGTCGCCTCTCCCCCGAGCTCGACGAGCTAAAAGGCTGGCCTACGCCTCCGCTCCTTCGGCAACACCACCGCCGGCTGTTTGCGAGTCCCCCAAACTCTAAGCCTAGCACCGCACGGGAGGGTGGGCAACGCCTCCTCCCTCGGTGGCGGAGATGGGTCTGATTGctttttcttttttctttAGGGTACAAAAGTGTCTGTTCCAGGTGTTAATTTCTAGTGCAAAATGTACAGTCCAAAAATTGGATCTTATTCCTTGTACAGAGCCATGTTTTACTTGCTTGTAAGTAATCCATATGCATCGATGAATACCTGGGTACTGATGCATCAAGTTTATTTCTCAAAGATTGTGGAGTGTGCTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.47059 translated coding region predicted by ESTScan from UniGene Ta.47059

XRDESIAKPASTQLVDEERQPQDLXSQRRTNSSTGEDRTCLPHVVVKAKGWFCKKHCVTQAIHSRGSXSSNGAEPRNNMAESAVRTVLGSVGNLAVQETTFLCAVNLEVGLLKDELMRLQAYLKDVDCKWRSGNARVAVLVSQIRAAAYEAQNVVEAADHMEKRIRLKKGFMGAISRYARLPTDLVTLRKIGVEIQYVRRKLNEIFASADHLKIELDNIVVVEDEFLRDCGPMNGNFEDDAVMVGFEDEHKELANKLVSGEQMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQIMSVILARSYKDLPNHHLRSCLLYFAAFPEDYEIYVTHLIELWIAESFIPHTPNHTLEETARSYVTELAQRSLVQVVRRSTAYGWIERIRIHDILHDWCIQEARQDGFLDTSNKTAGQAGASSSSSDNLICYRFSFQTLSDQILPATPNVRSLLGFELESVSLPKLRFLRVLCIENSTLKDFSSVIGGCIHLLLAYMPYNPEEDDITQKELRQKGCKVENGGTFHDMDDNLSLLQCPLAPPSRSAMPMPISPPPHLPVQSAVMRLSXGGLGEPLHNADLHSRCQGRRSPLPRARRAKRLAYASAPSATPPPAVCESPKL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
220-482 P-loop containing nucleoside triphosphate hydrolases

VVVEDEFLRDCGPMNGNFEDDAVMVGFEDEHKELANKLVSGEQMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQI

HMMPfam: PF00931
IPR002182
247-531 NB-ARC,NBS
NB-ARC

EDEHKELANKLVSGEQMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQIMSVILARSYKDLPNHHLRSCLLYFAAFPEDYEIYVTHLIELWIAESFIP

Gene3D: G3DSA:3.40.50.300
262-391 no description

QMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVAN

FPrintScan: PR00364
IPR000767
266-281 DISEASERSIST
Disease resistance protein

VVSIVAMGGAGKTTLA

HMMPanther: PTHR11017
267-590 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQIMSVILARSYKDLPNHHLRSCLLYFAAFPEDYEIYVTHLIELWIAESFIPHTPNHTLEETARSYVTELAQRSLVQVVRRSTAYGWIERIRIHDILHDWCIQEARQDGFL

FPrintScan: PR00364
IPR000767
342-356 DISEASERSIST
Disease resistance protein

FLLENKYLVVLDDVW

FPrintScan: PR00364
IPR000767
444-458 DISEASERSIST
Disease resistance protein

CDGLPLALRVLGGYL

Seg: seg
603-607 seg

SSSSS

Seg: seg
718-738 seg

PLAPPSRSAMPMPISPPPHLP

Seg: seg
767-793 seg

RRSPLPRARRAKRLAYASAPSATPPPA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox