PRGDB00077866 (Ta.47140)

From PRG Wiki
Jump to: navigation, search
Ta.47140
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241983764 (AK331706)
Gene Class Mlo-like
Domain Type MLO
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT002_C14, cultivar: Chinese Spring

DNA Sequence

ATCCTCCACCACCTCGGCCAGTGGTTCAGCAAGAGGAAGAAGAAGGCGCTGTTCGACGCTCTGGAGAAGGTTAAATCCGAGCTCATGACTCTGGGCTTCATCTCGCTGCTGCTGACTGTCACGGCGAGGTACATATCGCGCATCTGCATCCCGGCGGGGGCCGCCGACACCATGCTGCCCTGCAAGCTCTCCAGGAGCTCGGAGCACGGAGAGGGCCACGGCCGACGGCACCTGTCTGAAGAGCCGGCCTACTTCTCATGCCCCAAAGTGAGTTGACTACTGTCAACTGCGTGGTTTACATTGTGCTGTAGCAAGGTGTGTCACATTGATTTGGGTACCAGTGATTGGGGGTCAGGGTATCGAGATTGATATTTTATTGTATTTTATTTCATCTGTTCCTATTATCTTCAGAAATGGTCTGGTCATTCCAAAATTGTTTGTTTTTATTCTCGGAATCCCAATGCCATTTCAGGGTATGGTGTCACTCGTTTCAACCGATGGGCTACACCAGCTACATATCTTCGTGTTCTTCCTGGCCGTCTTCCATGTAACGTTCAGTGCTATTACAATGTCCCTGGGCAGAGCAAAGACGCGGATATGGAAGGAGTGGGAAAAGGATACTTCCTCCATCACCTATGAATTTTCAGCCGATCCATCGAAATTCCGGCTCACTCACCAGACTTCTTTTGTGAGGCAGCACGCAAGCTGTTGGAGCAAAAGCACGATTATGCTCTATGTCGTGAGCTTCTTTAGGCAGTTTTTCAGATCTGTTCGGAGGACAGACTACCTGACTTTGCGGCACGGATTCATTGCTGCTCATTTATCCCCAGGGACTAGGTTCAACTTCCAAAAGTACATCAAGAGATCTTTGCAGGATGATTTCAAGACAGTTGTTGGCATTAGTCCACCTCTATGGGCTTCTGCTCTGGCTGTCATGCTCTTCAATGTTCATGGATGGCATAACTTGTTCTGGTTCTCCACAATTCCCCTTATAGTGATTTTAGCTGTTGGAACAAAGCTGCAGGCTATTATTGCAAGGATGGCTGTTGAAATTACAGAAAAACACACAGTTATTCAAGGAATGCCAGTGGTGAAACTCAGTGATGAACATTTCTGGTTCGGAAAGCCTCATATGGTTCTTCACCTTATCCATTTTGCATTATTCCAGAATGCATTTGAGATTACTTATTTCTTTTGGATTTGGTATGAATTCGGCTTGAGGTCCTGTTTCCATGACAACTTTGAGTTTATCATTGCAAGGATCTGCCTTGGGGGTGTCGTCCAATTTGTGTGCAGCTATATCACGCTTCCGCTCCATGCCCTTGTATCTCAGATGGGATCTTCGATGAAGCGAACCATCTTCGACGAGCAGACGTCGAAGGCCCTGAAGAAGTGGCACAAGACGGTGAAGAAGAagcagcagcagcaacagcagcagAAGGGATCATCGCATGCCTCCTCAGAGACGCCAACCACGGACACGCCCGAGGCAGGCCGGCTTAGCCAGTGCCAGTTCGTCGCCGAGGCGGCGCCGGTGGCGAACCGGCACCTCCACCGCTACAAGACCATAGCGCACGTCGGCGCCACCAGGGCGCTCTCTGACTCGGACTGCTCAGACACCGATGCCGAGGCGCAGACGAGGTACCTGATCCCGCCCACGAAGCAGAGGAGCCTGGACTCAGAGGTCCGTGTGGACGTGGACGCCGCGACGCCGGATCACCGTGATAGTTTCTCCTTTCAGAGGCCGCCGCCTGCTCAGAATGCGATGGAGAAATGACCAAACGGGCGTAGGTCGTGCTTAGTATACTAATCAGTACTACTGACTTGTGTTAGATTAGAGGATGGGCAGACCGTCGAGGTGGGTAGGCAACTTTACCGTGCCATTTGGGGTGCATGAGAAGTCACAGGAATTTCGCTGGAGTTTTAGGGTAAACAGTTTAATTCCACGTCGCGGATAGAGAATCCTTGTGGTGCATTGCGTGATGGATGATCTTACTTTTCCTAAGGTTAATGATGAATTGTGGTaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.47140 translated coding region predicted by ESTScan from UniGene Ta.47140

XPPPPRPVVQQEEEEGAVRRSGEGXIRAHDSGLHLAAADCHGEVHIAHLHPGGGRRHHAALQALQELGARRGPRPTAPVXRAGLLLMPQSELTTVNCVVYIXAVARCVTLIWVPVIGGQGIEIDILLYFISSVPIIFRNGLVIPKLFVFILGIPMPFQGMVSLVSTDGLHQLHIFVFFLAVFHVTFSAITMSLGRAKTRIWKEWEKDTSSITYEFSADPSKFRLTHQTSFVRQHASCWSKSTIMLYVVSFFRQFFRSVRRTDYLTLRHGFIAAHLSPGTRFNFQKYIKRSLQDDFKTVVGISPPLWASALAVMLFNVHGWHNLFWFSTIPLIVILAVGTKLQAIIARMAVEITEKHTVIQGMPVVKLSDEHFWFGKPHMVLHLIHFALFQNAFEITYFFWIWYEFGLRSCFHDNFEFIIARICLGGVVQFVCSYITLPLHALVSQMGSSMKRTIFDEQTSKALKKWHKTVKKKQQQQQQQKGSSHASSETPTTDTPEAGRLSQCQFVAEAAPVANRHLHRYKTIAHVGATRALSDSDCSDTDAEAQTRYLIPPTKQRSLDSEVRVDVDAATPDHRDSFSFQRPPPAQNAMEKXPNGRRSCLVY

Domains

Domain Start-End Description Sequence

Seg: seg
1-15 seg

XPPPPRPVVQQEEEE

HMMPfam: PF03094
IPR004326
158-497 Mlo
Mlo-related protein

QGMVSLVSTDGLHQLHIFVFFLAVFHVTFSAITMSLGRAKTRIWKEWEKDTSSITYEFSADPSKFRLTHQTSFVRQHASCWSKSTIMLYVVSFFRQFFRSVRRTDYLTLRHGFIAAHLSPGTRFNFQKYIKRSLQDDFKTVVGISPPLWASALAVMLFNVHGWHNLFWFSTIPLIVILAVGTKLQAIIARMAVEITEKHTVIQGMPVVKLSDEHFWFGKPHMVLHLIHFALFQNAFEITYFFWIWYEFGLRSCFHDNFEFIIARICLGGVVQFVCSYITLPLHALVSQMGSSMKRTIFDEQTSKALKKWHKTVKKKQQQQQQQKGSSHASSETPTTDTPE

Seg: seg
247-260 seg

VVSFFRQFFRSVRR

Seg: seg
464-481 seg

KKWHKTVKKKQQQQQQQK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox