PRGDB00077886 (Ta.48567)

From PRG Wiki
Jump to: navigation, search
Ta.48567
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241984980 (AK332240)
Gene Class Mlo-like
Domain Type MLO
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT003_H24, cultivar: Chinese Spring

DNA Sequence

GGGCTCGGCAAGGCGggagaggaggaggaggaggaggagatggggcaggaggaggaggCGCAGTCGCTGGCGCTCACGCCGACGTGGGTGGTCGCCTCCGTCTGCCTCGTCATCGTCGCCATCTCCCTCGCCGCCGAGCGCCTGCTCCACCGCCTCGGCAAGGTGCTCAAATTCAATGGACAAGAAGCACTATTCTCAGCCCTGCAGAGAGTCAAAGAAGAGTTGATGATTCTGGGTTTCATTTCCTTCCTACTAAGCGTCTGTCAAAATCTCATCAACCGCATTTGCATCCCCGAGAGCGCTGCACGTATCATGCTTCCATGCATTGAAGAGTCCAAAGCCAGAGAAGATGCTGCCACATTCTGCAAGAGAAAGGGTGAAGTTCCCATGCTATCTGAAGAGGCTCTGCATCAGCTGCACATCTTTATCTTTGTACTTGGTGTGGTGCATGTTTTGTTCTGTGTTACAACGCTGTTACTTGGTGGAGCTAAGATGAGAACGTGGAATAAATGGGAGAAAGAAATTCAACAAGGAAGAATCAAGGAGCGTGAAAAGACGCCAGGCTGGATGAAACCATCTGCTGTAAGATGGATTATTGCATTCTTCAAGCAGTTTTATAATTCTGTCGGTAAACCAGATTATCAAGTACTCAGATCAGCTTTTGTTCTGCGGCACTACCCAAATTGCCCAGACTTTGATTTCCACAAGTACATGGTTCGTGCCCTCGAGCATGACTTCAAAGAAGTAGTTGGAATCAGCTGGTACCTATGGCTTTTCGTTATCGTCTTCCTGCTGCTGAATATAAATGGGTGGCACACTTACTTCTGGCTGTCTTTCTTGCCCTTGATTCTTCTGCTTATTGTTGGCACTAAGCTGGAGCACATCAGCACTCGATTGGCTCAAGAAGCAGCGGAGTGTTCCGATGAAGCATCAGGAAACCCCTGGACGAAGCCATGCAAGGAGCACTTTTGGTTTAGCCATCCTAGGGCTGTCCTCCATCTGATCCATTTCATCTTGTTCCAGAACTCGTTTGAGATGGCATTTTTCTTCTGGGTCTTGGCAACATATGGGTTCGATTCATGCATCATGGAGAACAGATCATATGCCATCCCCAGACTTGCTATTGGCATCATCGTTCAGGTGCTCTGCAGCTACAGCACCCTGCCGCTGTACGCCATTGTCACCCACATGGGCGGCGACATCAAGCTGCAGGCGTTCGGCGAGCACGTACACGTGTCCGTGCACAGCTGGGCGACGGACGTGAAGAAGAAGGCGACGTCGCTGCCGGCCCATCCGCACCCGCACCAGCACCCGCACTCGCACCTCCGGATCCCGTTTCTCAACAAGAAGCGGCACAGCGGACGTGGCCCTGCAACCGAGGAGGCTGCAGCCGCGGCGAGGGCGACGGAGCAGCGCGCTGGAAGCTCCAGCTCTCCCACCGCACCGCCGCAGCAGCGGGCCGACGACCTAGAGGAGATCGTGACGACCACGGAGGAGGACCATCGTCGTCGCAACGCCAGTTTCTCGTAGCTGCGTACATGCTCGCGTTACTAAGTCCTAACGGTAGGCCGGGCGCATGGGCCGCGTCTCGCTGTCGACGTTGTCGTCGTCATCCGGCAGGCCCCAGGCCGAAGCCACCGCCGACGTCGTCATCGTTGGCGTTCTAAGCAGACTAGCTATGACATGTTCTACTGGACCGTCGCGCGATCTCAACACTTTGAAACTTTGACaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.48567 translated coding region predicted by ESTScan from UniGene Ta.48567

XARQGGRGGGGGGDGAGGGGAVAGAHADVGGRLRLPRHRRHLPRRRAPAPPPRQGAQIQWTRSTILSPAESQRRVDDSGFHFLPTKRLQNLINRICIPESAARIMLPCIEESKAREDAATFCKRKGEVPMLSEEALHQLHIFIFVLGVVHVLFCVTTLLLGGAKMRTWNKWEKEIQQGRIKEREKTPGWMKPSAVRWIIAFFKQFYNSVGKPDYQVLRSAFVLRHYPNCPDFDFHKYMVRALEHDFKEVVGISWYLWLFVIVFLLLNINGWHTYFWLSFLPLILLLIVGTKLEHISTRLAQEAAECSDEASGNPWTKPCKEHFWFSHPRAVLHLIHFILFQNSFEMAFFFWVLATYGFDSCIMENRSYAIPRLAIGIIVQVLCSYSTLPLYAIVTHMGGDIKLQAFGEXRTRVRAQLGDGREEEGDVAAGPSAPAPAPALAPPDPVSQQEAAQRTWPCNRGGCSRGEGDGAARWKLQLSHRTAAAAGRRPRGDRDDHGGGPSSSQRQFLVAAYMLALLSPNGRPGAWAASRCRRCRRHPAGPRPKPPPTSSSLAF

Domains

Domain Start-End Description Sequence

Seg: seg
5-53 seg

GGRGGGGGGDGAGGGGAVAGAHADVGGRLRLPRHRRHLPRRRAPAPPPR

HMMPfam: PF03094
IPR004326
88-409 Mlo
Mlo-related protein

LQNLINRICIPESAARIMLPCIEESKAREDAATFCKRKGEVPMLSEEALHQLHIFIFVLGVVHVLFCVTTLLLGGAKMRTWNKWEKEIQQGRIKEREKTPGWMKPSAVRWIIAFFKQFYNSVGKPDYQVLRSAFVLRHYPNCPDFDFHKYMVRALEHDFKEVVGISWYLWLFVIVFLLLNINGWHTYFWLSFLPLILLLIVGTKLEHISTRLAQEAAECSDEASGNPWTKPCKEHFWFSHPRAVLHLIHFILFQNSFEMAFFFWVLATYGFDSCIMENRSYAIPRLAIGIIVQVLCSYSTLPLYAIVTHMGGDIKLQAFGEX

Seg: seg
277-286 seg

LSFLPLILLL

Seg: seg
428-445 seg

AAGPSAPAPAPALAPPDP

Seg: seg
480-501 seg

HRTAAAAGRRPRGDRDDHGGGP

Seg: seg
531-548 seg

RCRRCRRHPAGPRPKPPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox