PRGDB00077888 (Ta.48659)

From PRG Wiki
Jump to: navigation, search
Ta.48659
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19950157 (BJ211244)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

BJ211244 Y. Ogihara unpublished cDNA library, Wh Triticum aestivum cDNA clone wh38k20 5', mRNA sequence

DNA Sequence

CATGGCGCTCAAGAGGAGTAGATGTAGATCCATCGCCTTCCTCAACCGCCATTGCTAGCTAGCTCCTCAAGCTGCCGGGGGATTTGGCTGGCATTTTGATACGGTCGCTCAACACCCTACATCGGATCTTGCTGGAGGGTTTCAACAGAGGGCGGCCGGCAGACAGCAGCATTTGGAGGCTGCCGCCCAACAGTCTGCTCAGCTATGCTTTGCTTCTGCTTGTACTCTGTAGGACTGCTTCCTAGCTAAAGGATCCATACACTGAGAAAGAAGATCCACCGGTTCCACCATGGAGGTGGTGACCGGTGCCATGGGAAGCTTGCTCCCCAAGCTCGGCGAGCTGCTCGTGAGTGAGTACAAGCTGCAAAAGGGCGTCAAGGAGGACGTCGAGTCCCTCGAAAGGGAGATGAAGAGCATGAACGCTGCCCTCGTCAAGGTGGCGGAGGTGCCAAGGGACCAGCTGGACAACCAGGTCATCATCTGGGCTGACGAGCTCAGGGAGCTTTCGTACGACATGGAGGATGTTGTCGACAACTTTCTTGTGTACGTCAAGGGATCTGAATCCCGATGCTGTCACCG


Protein sequences

Name Description Sequence
Ta.48659 translated coding region predicted by ESTScan from UniGene Ta.48659

XMALKRSRCRSIAFLNRHCXLAPQAAGGFGWHFDTVAQHPTSDLAGGFQQRAAGRQQHLEAAAQQSAQLCFASACTLXDCFLAKGSIHXERRSTGSTMEVVTGAMGSLLPKLGELLVSEYKLQKGVKEDVESLEREMKSMNAALVKVAEVPRDQLDNQVIIWADELRELSYDMEDVVDNFLVYVKGSESRCCHR

Domains

Domain Start-End Description Sequence

Seg: seg
45-57 seg

AGGFQQRAAGRQQ

HMMPanther: PTHR23155:SF164
101-182 OS08G0170200 PROTEIN,OS08G0170200 PROTEIN

VTGAMGSLLPKLGELLVSEYKLQKGVKEDVESLEREMKSMNAALVKVAEVPRDQLDNQVIIWADELRELSYDMEDVVDNFLV

HMMPanther: PTHR23155
101-182 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTGAMGSLLPKLGELLVSEYKLQKGVKEDVESLEREMKSMNAALVKVAEVPRDQLDNQVIIWADELRELSYDMEDVVDNFLV

Coil: coil
123-151 coiled-coil

QKGVKEDVESLEREMKSMNAALVKVAEVP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox