PRGDB00077895 (Ta.48801)

From PRG Wiki
Jump to: navigation, search
Ta.48801
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14334166 (AF384144)
Gene Class Mlo-like
Domain Type MLO
Gene Species Triticum aestivum

Comment?

Triticum aestivum MLo protein mRNA, complete cds

DNA Sequence

GGCCGCGGGAATTCGATTGTGCATCTGCGTGTGCGTACGTACGTTTTCGTTTTCCTTTCTTGCTCCGGCCGGCCGGCCGGCCACGTAGAATAGATACCTGCCCAGGTACGTACCTCGTTGGCTCAGACGATCGGCGGTTGGACTTGGGTGCGCGCCCTGCCCTGCTCCGGCCAAGGAAAGAGGTTGCGCTAAAGACGGGCGGATGGCAAAGGACGACGGGTACCCCCCGGCGCGGACGCTGCCGGAGACGCCGTCCTGGGCGGTGGCGCTGGTCTTCGCCGTCATGATCATCGTCTCCGTCCTCCTGGAGCACGCGCTCCACAAGCTCGGCCATTGGTTCCACAAGCGGCACAAGAACGCGCTGGCGGAGGCGCTGGAGAAGATGAAGGCGGAGCTGATGCTGGTGGGATTCATCTCGCTGCTGCTCGCCGTCACGCAGGACCCAATCTCCGGGATATGCATCTCCCAGAAGGCCGCCAGCATCATGCGCCCCTGCAAGGTGGAACCCGGTTCCGTCAAGAGCAAGTACAAGGACTACTACTGCGCCAAAGAGGGCAAGGTGGCGCTCATGTCCACGGGCAGCCTGCACCAGCTCCACATATTCATCTTCGTGCTAGCCGTCTTCCATGTCACCTACAGCGTCATCATCATGGCTCTAAGCCGTCTCAAGATGAGAACATGGAAGAAATGGGAGACAGAGACCGCCTCCTTGGAATACCAGTTCGCAAATGATCCTGCGCGGTTCCGCTTCACGCACCAGACGTCGTTCGTGAAGCGGCACCTGGGCCTGTCCAGCACCCCCGGCGTCAGATGGGTGGTGGCCTTCTTCAGGCAGTTCTTCAGGTCGGTCACCAAGGTGGACTACCTCATCTTGAGGGCAGGCTTCATCAACGCGCACTTGTCGCAGAACAGCAAGTTCGACTTCCACAAGTACATCAAGAGGTCCATGGAGGACGACTTCAAAGTCGTCGTTGGCATCAGCCTCCCGCTGTGGGCTGTGGCGATCCTCACCCTCTTCCTTGATATCGACGGGATCGGCACACTCACCTGGGTTTCTTTCATCCCTCTCATCATCCTCTTGTGTGTTGGAACCAAGCTAGAGATGATCATCATGGAGATGGCCCTGGAGATCCAGGACCGGTCGAGCGTCATCAAGGGGGCACCCGTGGTCGAGCCCAGCAACAAGTTCTTCTGGTTCCACCGCCCCGACTGGGTCCTCTTCTTCATACACCTGACGCTGTTCCAGAACGCGTTTCAGATGGCACATTTCGTGTGGACAGTGGCCACGCCCGGCTTGAAGGACTGCTTCCATATGAACATCGGGCTGAGCATCATGAAGGTCGTGCTGGGGCTGGCTCTCCAGTTCCTGTGCAGCTACATCACCTTCCCCCTCTACGCGCTAGTCACACAGATGGGATCAAACATGAAGAGGTCCATCTTTGACGAGCAGACAGCCAAGGCGCTGACCAACTGGCGGAACACGGCCAAGGAGAAGAAGAAGGTCCGAGACACGGACATGCTGATGGCGCAGATGATCGGCGACGCAACACCCAGCCGAGGCACGTCCCCGATGCCTAGCCGGGGCTCATCGCCGGTGCACCTGCTTCAGAAGGGCATGGGACGGTCTGACGATCCCCAGAGCGCACCGACCTCGCCAAGGACCATGGAGGAGGCTAGGGACATGTACCCGGTTGTGGTGGCGCATCCTGTACACAGACTAAATCCTGCTGACAGGCGGAGGTCGGTCTCTTCATCAGCCCTCGATGCCGACATCCCCAGCGCAGATTTTTCCTTCAGCCAGGGATGAGACAAGTTTCTG


Protein sequences

Name Description Sequence
Ta.48801 translated coding region predicted by ESTScan from UniGene Ta.48801

XPREFDCASACAYVRFRFPFLLRPAGRPRRIDTCPGTYLVGSDDRRLDLGARPALLRPRKEVALKTADGKGRRVPPGADAAGDAVLGGGAGLRRHDHRLRPPGARAPQARPLVPQAAQERAGGGAGEDEGGADAGGIHLAAARRHAGPNLRDMHLPEGRQHHAPLQGGTRFRQEQVQGLLLRQRGQGGAHVHGQPAPAPHIHLRASRLPCHLQRHHHGSKPSQDENMEEMGDRDRLLGIPVRKXSCAVPLHAPDVVREAAPGPVQHPRRQMGGGLLQAVLQVGHQGGLPHLEGRLHQRALVQNSKFDFHKYIKRSMEDDFKVVVGISLPLWAVAILTLFLDIDGIGTLTWVSFIPLIILLCVGTKLEMIIMEMALEIQDRSSVIKGAPVVEPSNKFFWFHRPDWVLFFIHLTLFQNAFQMAHFVWTVATPGLKDCFHMNIGLSIMKVVLGLALQFLCSYITFPLYALVTQMGSNMKRSIFDEQTAKALTNWRNTAKEKKKVRDTDMLMAQMIGDATPSRGTSPMPSRGSSPVHLLQKGMGRSDDPQSAPTSPRTMEEARDMYPVVVAHPVHRLNPADRRRSVSSSALDADIPSADFSFSQGXDKFL

Domains

Domain Start-End Description Sequence

Seg: seg
74-92 seg

VPPGADAAGDAVLGGGAGL

Seg: seg
98-111 seg

RLRPPGARAPQARP

Seg: seg
121-136 seg

AGGGAGEDEGGADAGG

Seg: seg
172-188 seg

RQEQVQGLLLRQRGQGG

Seg: seg
270-288 seg

QMGGGLLQAVLQVGHQGGL

HMMPfam: PF03094
IPR004326
300-543 Mlo
Mlo-related protein

LVQNSKFDFHKYIKRSMEDDFKVVVGISLPLWAVAILTLFLDIDGIGTLTWVSFIPLIILLCVGTKLEMIIMEMALEIQDRSSVIKGAPVVEPSNKFFWFHRPDWVLFFIHLTLFQNAFQMAHFVWTVATPGLKDCFHMNIGLSIMKVVLGLALQFLCSYITFPLYALVTQMGSNMKRSIFDEQTAKALTNWRNTAKEKKKVRDTDMLMAQMIGDATPSRGTSPMPSRGSSPVHLLQKGMGRSD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox