PRGDB00077993 (Ta.56741)

From PRG Wiki
Jump to: navigation, search
Ta.56741
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241983145 (AK331085)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: SET6_A14, cultivar: Chinese Spring

DNA Sequence

GAGCCATCCTAGGGTTCACTATTTTGTTCAATATATTGTACATTCTGGCGCTTACGCACTTGAGCCCTCCCAGCGGCTCAAACACAGTTTCGGACCAAGAGAATGAGAATGAGACAAACACTTCAACACCGATGGGTACTAATGATGAAGCCACAAATCGAGCAACTCAGACACAAATCACCCTGCCTTTCCAGCCTCTTGCACTATCTTTCAACCATGTAAACTATTACGTGGACATGCCTGCAGAAATGAGAGAGCAAGGATTCGCCGAAAGTCGTCTCCAGTTGCTCTCTGATATCAGTGGTGCTTTTAGGCCAGGTGTTCTGACAGCATTAGTTGGTGTGAGTGGAGCTGGGAAAACCACTCTAATGGATGTCCTCGCAGGAAGGAAAACCAGTGGGTCGATTGAAGGAAGCATCACCCTCTCTGGTTACCCTAAAAAGCAAGAAACTTTTGCCCGCATCAGTGGCTACTGCGAACAGACCGATATCCATTCACCAAATGTTACTGTATATGAATCCATTCTCTACTCTGCCTGGCTGCGTCTTTCCTCAGATGTTGACGAAAAAACGAGAAAGTTGTTTGTGGAGGAAGTCATGACTCTTGTGGAGCTTGATGTGTTGCGTAATGCTATGGTTGGCCTCCCTGGAGTGGACGGGTTATCGACCGAACAAAGAAAGAGACTGACAATTGCCGTGGAGCTGGTAGCAAATCCTTCAATCATATTCATGGATGAGCCAACTTCTGGACTTGATGCTAGAGCCGCAGCAATTGTAATGCGGGCAGTGAGAAATACAGTCAACACTGGGCGAACTGTGGTTTGCACTATCCATCAACCCAGCATTGATATATTCGAGTCTTTTGACGAGCTTCTGCTTATGAAAAGAGGAGGACAAGTTATTTATGCTGGTGAACTTGGTCGCCACTCTTATAAACTAGTTGAATATTTTGAGGCAATTCCAGGTGTTGAAAAGATCACACAAGGATATAATCCCGCAACATGGATGCTGGAAGTTAGCTCCCCTTTAGCCGAGGCTCGCCTGAACGTAAACTTTGCTGAAATTTATGCTAATTCTGAACTTTATAGGGAAAACCAACAACTTATTAAGGAATTAAGCGTTCCTCCGCCAGGCTACGAGGATCTCTCATTCCCTACCAAGTATTCTCAGAATTTCTACAACCAATGCATTGCAAACTTCTGGAAGCAATACAAATCATATTGGAAGAATCCGCCCCACAACGCCATGCGCTTTCTCATGACCATGATTAATGGCCTTGTATTTGGCACGGTGTTTTGGCAGATAGGGACGAAAATAGGCTCGCAACAAGATCTCTTCAATCTACTTGGAGCCACTTATGCTGCTGTCTTCTTCCTTGGAGCCGCCAACTGCATCACGGTTCAGCCTGTTGTGTCAATCGAGCGAACAGTTTTCTACCGTGAAAAGGCGGCAGGGATGTACTCTCCGTTATCCTATGCATTCGCTCAGACATGCGTGGAGGTGATGTACAACATCGTGCAGGGGATTGAATACACGGCGATCATCTATGCGATGATTGGATATGAGTGGAAAGCGGCAAAGTTCTTCTATTTCCTCTTCTTCATAGTTTCAAGCTTCAACTACTTCACATTGTTTGGCATGATGCTGGTGTCACTGACTCCCTCTTCCATGCTCGCAAACATACTGATATCCTTTGTACTCCCTCTTTGGAACCTGTTTGCTGGGTTCCTCGTCGTCAGACCGTTGATACCCATCTGGTGGAGGTGGTACTACTGGGCCAACCCTGTGTCATGGACCATCTACGGCGTGGTGGCGTCGCAGTTTGGCGACAACAAGAGTCCTCTCAAGGTCCCCGGCGGGAGCGACACGTTTGTGAAGCAGTTCTTGGAGGACAACCTGGGCATCAAGCACGATTTCCTTGGGTATGTGGTGCTGGCGCACTTTGCGTTCATCATCGCCTTCTTCTTTGTGTTTGGCTACTCCATCAAGGTGTTGAACTTCCAGAAACGTTAGGCCTTCTTCTTTATTTAATTTATATATAATATAGTGTTTGTGTGTATATGAATGAATGCAATGTAATGTATAGTAGAAAGAGTAGAGTTGACAAGGGAAATTGTTGCATAGATAGGCCAGACCTGGTACGTATAAATTAGAGGAATGAGACGAGAGGTGGTGGTGACATGATGCCTAttttttgttttgttttACCATTGACATTGATATATTAAATACGAAAAGTTCATTTTTGGTGCaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.56741 translated coding region predicted by ESTScan from UniGene Ta.56741

XAILGFTILFNILYILALTHLSPPSGSNTVSDQENENETNTSTPMGTNDEATNRATQTQITLPFQPLALSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGQVIYAGELGRHSYKLVEYFEAIPGVEKITQGYNPATWMLEVSSPLAEARLNVNFAEIYANSELYRENQQLIKELSVPPPGYEDLSFPTKYSQNFYNQCIANFWKQYKSYWKNPPHNAMRFLMTMINGLVFGTVFWQIGTKIGSQQDLFNLLGATYAAVFFLGAANCITVQPVVSIERTVFYREKAAGMYSPLSYAFAQTCVEVMYNIVQGIEYTAIIYAMIGYEWKAAKFFYFLFFIVSSFNYFTLFGMMLVSLTPSSMLANILISFVLPLWNLFAGFLVVRPLIPIWWRWYYWANPVSWTIYGVVASQFGDNKSPLKVPGGSDTFVKQFLEDNLGIKHDFLGYVVLAHFAFIIAFFFVFGYSIKVLNFQKR

Domains

Domain Start-End Description Sequence

HMMPfam: PF08370
IPR013581
2-29 PDR_assoc
Plant PDR ABC transporter associated

AILGFTILFNILYILALTHLSPPSGSNT

HMMPanther: PTHR19241:SF10
31-670 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

SDQENENETNTSTPMGTNDEATNRATQTQITLPFQPLALSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGQVIYAGELGRHSYKLVEYFEAIPGVEKITQGYNPATWMLEVSSPLAEARLNVNFAEIYANSELYRENQQLIKELSVPPPGYEDLSFPTKYSQNFYNQCIANFWKQYKSYWKNPPHNAMRFLMTMINGLVFGTVFWQIGTKIGSQQDLFNLLGATYAAVFFLGAANCITVQPVVSIERTVFYREKAAGMYSPLSYAFAQTCVEVMYNIVQGIEYTAIIYAMIGYEWKAAKFFYFLFFIVSSFNYFTLFGMMLVSLTPSSMLANILISFVLPLWNLFAGFLVVRPLIPIWWRWYYWANPVSWTIYGVVASQFGDNKSPLKVPGGSDTFVKQFLEDNLGIKHDFLGYVVLAHFAFIIAFFFVFGYSIKVLNFQKR

HMMPanther: PTHR19241
31-670 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

SDQENENETNTSTPMGTNDEATNRATQTQITLPFQPLALSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGQVIYAGELGRHSYKLVEYFEAIPGVEKITQGYNPATWMLEVSSPLAEARLNVNFAEIYANSELYRENQQLIKELSVPPPGYEDLSFPTKYSQNFYNQCIANFWKQYKSYWKNPPHNAMRFLMTMINGLVFGTVFWQIGTKIGSQQDLFNLLGATYAAVFFLGAANCITVQPVVSIERTVFYREKAAGMYSPLSYAFAQTCVEVMYNIVQGIEYTAIIYAMIGYEWKAAKFFYFLFFIVSSFNYFTLFGMMLVSLTPSSMLANILISFVLPLWNLFAGFLVVRPLIPIWWRWYYWANPVSWTIYGVVASQFGDNKSPLKVPGGSDTFVKQFLEDNLGIKHDFLGYVVLAHFAFIIAFFFVFGYSIKVLNFQKR

superfamily: SSF52540
61-308 P-loop containing nucleoside triphosphate hydrolases

TLPFQPLALSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGQVIYAGELGR

ProfileScan: PS50893
IPR003439
69-322 ABC_TRANSPORTER_2
ABC transporter-like

LSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGQVIYAGELGRHSYKLVEYFEAIPG

Gene3D: G3DSA:3.40.50.300
70-305 no description

SFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGQVIYAGE

HMMSmart: SM00382
IPR003593
106-298 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGG

HMMPfam: PF00005
IPR003439
121-249 ABC_tran
ABC transporter-like

TTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKLFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTS

Seg: seg
253-276 seg

ARAAAIVMRAVRNTVNTGRTVVCT

HMMPfam: PF01061
IPR013525
395-608 ABC2_membrane
ABC-2 type transporter

QCIANFWKQYKSYWKNPPHNAMRFLMTMINGLVFGTVFWQIGTKIGSQQDLFNLLGATYAAVFFLGAANCITVQPVVSIERTVFYREKAAGMYSPLSYAFAQTCVEVMYNIVQGIEYTAIIYAMIGYEWKAAKFFYFLFFIVSSFNYFTLFGMMLVSLTPSSMLANILISFVLPLWNLFAGFLVVRPLIPIWWRWYYWANPVSWTIYGVVASQF

Seg: seg
528-539 seg

FFYFLFFIVSSF

Seg: seg
648-658 seg

FAFIIAFFFVF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox