PRGDB00078014 (Ta.61127)

From PRG Wiki
Jump to: navigation, search
Ta.61127
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 55599970 (CV760556)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

FGAS054942 Triticum aestivum FGAS: Library 2 Gate 3 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

ctagcatttggtgaactatagaaaagtttctacaaaaaagcaggctggtaccggtccggaattcccgggatatcgTCGACCCACGCGTCCGACTGCAATAACATCACTTCCAGAATGTGATGCATTGGTTGCATTGGAGCATCTGAATTTGTCTCACACACACATTATGAGATTACCTGAGCGCCTATGGTTACTGAAAGAGTTGAGGCATTTGGATCTGAGTGTGACTGTTGCACTTGAAGATACCATGAACAACTGCTCAAAGTTGCACAAGTTGAAAGTGCTCAATCTCTTCCGCAGCCACTACGGTATCCGTGATGTTGACAACCTGAATCTGGATTCTCTGAAGGAACTACTGTTCCTTGGAATCACTATTTATGCAGAGGATGTGCTAAAGAAATTGAACATGCCTCGTCCTTTGGCAAAGTCAACACATCGCTTAAACTTGAAGTATTGTGCAGATATGCAATCAATCAAAATCTCTGACCTCAGCCACATGGAGCACCTTGAGGAGCTGTATGTTGAATCATGCTATGACCTGAACACAGTGGTTGCTGATGCTGAGCTTACAACTTCACAGTTGCAGTTCCTGACCCTGTCAGTTCTTCCCTCGTTGGAAAGTGTCCTTATTGCACCAATGTCCCATAATTTTCAGTACATCCGCAAATTGATCATTTCACACTGCCCCAAGTTGTCGAACATCACATGGGTCCGAAGGCTTCAGCTTCTTGAGAGGCTTGTCATATCNTCATTGTGATGGGGTGCTCGAAATTGTTGAAGATGAGGAGCAGTATGGAGAACAAATGAAATGCAGGATCATGCTTCAGATGAANCAGAAGATCATGCTATGGT


Protein sequences

Name Description Sequence
Ta.61127 translated coding region predicted by ESTScan from UniGene Ta.61127

XXHLVNYRKVSTKKQAGTGPEFPGYRRPTRPTAITSLPECDALVALEHLNLSHTHIMRLPERLWLLKELRHLDLSVTVALEDTMNNCSKLHKLKVLNLFRSHYGIRDVDNLNLDSLKELLFLGITIYAEDVLKKLNMPRPLAKSTHRLNLKYCADMQSIKISDLSHMEHLEELYVESCYDLNTVVADAELTTSQLQFLTLSVLPSLESVLIAPMSHNFQYIRKLIISHCPKLSNITWVRRLQLLERLVISSCDGVLEIVEDEEQYGEQMKCRIMLQMXQKIMLWX

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
34-252 no description

ITSLPECDALVALEHLNLSHTHIMRLPERLWLLKELRHLDLSVTVALEDTMNNCSKLHKLKVLNLFRSHYGIRDVDNLNLDSLKELLFLGITIYAEDVLKKLNMPRPLAKSTHRLNLKYCADMQSIKISDLSHMEHLEELYVESCYDLNTVVADAELTTSQLQFLTLSVLPSLESVLIAPMSHNFQYIRKLIISHCPKLSNITWVRRLQLLERLVISSC

superfamily: SSF52058
34-252 L domain-like,LRR

ITSLPECDALVALEHLNLSHTHIMRLPERLWLLKELRHLDLSVTVALEDTMNNCSKLHKLKVLNLFRSHYGIRDVDNLNLDSLKELLFLGITIYAEDVLKKLNMPRPLAKSTHRLNLKYCADMQSIKISDLSHMEHLEELYVESCYDLNTVVADAELTTSQLQFLTLSVLPSLESVLIAPMSHNFQYIRKLIISHCPKLSNITWVRRLQLLERLVISSC

Seg: seg
190-203 seg

LTTSQLQFLTLSVL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox