PRGDB00078019 (Ta.63119)

From PRG Wiki
Jump to: navigation, search
Ta.63119
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 220683794 (FJ185035)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum PDR-type ABC transporter (PDR1) mRNA, complete cds

DNA Sequence

TTCGGGAGCAGTGCTATTCTCTGCATCACATGCACATGTGCTGACTAGTCGTAGCCGTCGTTGGAAGTTTCTGTCATTTCATGTGGAAACATCCAGATGCAGCCTTACATGCACGCATGACCTCCCTTCCCTTCCCTTCCCTATATATGCTTTGCTTTGCTTCCTACTGCTAGAAAATTAAAGGTCACGGACagacagacaggcacagaaagagagagactgtctgcatcgccacagacaggcacagaaagagagaGACTGTCTGCATCGCCATGGAGCTGGCCTCGGGCAGGGGCAGCCGCCGCAGTGCCAGCGCGGCCTCCTGGGGCTCCCGCCGCTCCTTCTCCATCCACAGCCAGGCGGCGGACCCCTTCGGCCGCGCCGCCTCGCAGCAGGGCCACCACGATGACGAGGAGAACCTGCGCTGGGCCGCGCTCGAGAAGCTGCCCACCTACGACCGCATGCGCCGCGCCGTCGTCCATGGCGGTGCCGCCGTCGACGGCCACGAGAATACGGAGATGGAGGGCTTGGTGGACATCAACCGCCTGGCCAGCGGCGAGGCCGGCAGGGCGCTGCTGGAGCGCGTCTTCCAGGACGACAGCGAGCGCTTCCTTAGGAGACTGAGGGACCGCGTGGACCGGGTGGGCATCGACCTGCCGGCGATCGAGGTCCGCTACCAGGGGCTCTCCGTCCAGGTGGACGCCTTCGTCGGCAGCCGGGCGCTGCCCACGCTCTGGAACTCGGCCACAAACTTCCTCCAGGGTCTTGTCGGCCGCCTTGCTTCCTCCAACAAGAAGACCATCCACATACTCCAAAATGTCAATGGCATCATCAAACCATCAAGGATGACCCTTCTTCTCGGACCTCCATCCTCAGGAAAGAGCACACTTATGCGTGCCCTCACTGGCAAGCTTGACAAAAGCCTCAAGGTATCTGGCAACATCACTTACTGTGGTCATACATTTGAGGAGTTCTACCCTGAGAGGACCAGTGTGTATGTTAGCCAGTACGATCTCCACAATGCAGAGATGACCGTAAGAGAGACGCTCGATTTCTCCAGGCGCTGCTTAGGCGTCGGTGCCAGATATGACATGCTCTCTGAGCTCGCTGCCAGGGAGCGCGAAGCTGGCATAAAGCCAGATCCCGAGATCGATGCTTATATGAAAGCTACTGCCGTGCAAGGACAGGAGAGTAATATTGTTACCGATCTTACTCTCAAGGTGCTTGGGCTTGATATTTGTGCCGATATGCCCATTGGTGACGACATGATCAGAGGAATTTCAGGCGGCCAAAAGAAGCGAGTAACAACTGGGGAGATGTTAACAGGACCTGCAAGAGCTTTGTTCATGGATGAAATTTCCACTGGTTTGGACAGCTCTAGCACATTTCAGATTGTGAAATACATAGGGCAATTGGTCCATGTGATGAATGAGACCGTGATGATCTCCCTCCTGCAACCACCGCCAGAGACCTACAACCTGTTTGATGACATTATTCTGCTATCAGAAGGGTACATAGTGTACCATGGGCCACGCGACAACATCTTGGAATTCTTCGAAGCTGCTGGTTTTAGGTGCCCTGAAAGGAAAGGAGTTGCTGACTTCCTTCAAGAGGTCACTTCCAAGAAAGACCAGCAACAGTACTGGTACCTTGACCAGGAGCAGTATCGTCACGTGTCTGTCCCAGAGTTTGCCGAACGATTCAAGTCATTCCACGTAGGCCAGCAGATGCTCAAGGAGCTGCAAATTCCTTTCGACAAGTCCCAAACTCATCCTGCTGCGCTGACCACCAGTAAGTATGGGCAATCCAGCTGGGAGTCATTCAAGACAGTGATGTCGAGAGAGCTGTTGTTGATGAAGCGCAACTCCTTCATCTACATCTTCAAGGTTACCCAGTTGCTCATCCTTGGGCTCGTGGCCATGACTGTGTTCTTCAGAACAAAGATGCCATATGGGCAGATTTCTGACAGCGCCAAATTCTTTGGTGCTCTGACTTTCAGTTTAATCACCGTCTTGTTCAATGGGTTTGCTGAGCTACAGTTTACTATTAAAATGCTTCCTACGTTCTACAAACAGAGAGATTTCTTGTTCTTTCCTCCATGGACCTTTGGACTGGTAAACATCATCTCGAAAGTTCCCGTTTCGCTTGTGGAGTCCTCGGTATGGGTCATACTCACGTACTACGTAATGGGCTTTGCACCTGCTGCAGGAAGGTTCTTTCGTCAGCTTTTAGCTTTCTTCCTTACTCACCAAATGGCAATGGGTTTATTCCGATTTCTTGGTGCTGTTTTGAAATCAATGGTTGTGGCCAATACCTTGGGGATGTTTGTGATCCTTATTATTTTTATATTTGGAGGGTTTGTCATACCTAGAGGTGACATCCAACCATGGTGGATCTGGGCTTACTGGTCATCTCCTATGATGTACAGTCAGAACGCGATATCAGTCAATGAATTCCTTTCCAGTAGGTGGGCCAACCCAAACAATGATACATCTATCGCTGCACGAACAGTAGGCGAGGCTATTCTTAAATCCAGAGGATTGTTTACTGGAGACTCGGGATTTTGGGTTTCCATCGGAGCCATTGTAGGATTCGCTATTCTGTTCAACATATTGTACCTTCTGGCACTTACGTATTTGAGCTTTGGCAGCAGCTCAAATACAGTTTCAGACGAGGAGAATGAGAATGAGACAAACACTTCAATGCCTATAGATGAAGCCACAAATCGGCCAACTCGGTCACAAATCACCTTGCCTTTCCAGCCTCTTTCACTTTCTTTCAACCATGTTAACTATTACGTGGACATGCCTGCAGAAATGAGAGAACAAGGATTCGCCGAAAGTCGTCTCCAGTTGCTCTCCGATATCAGTGGTGCTTTTAGGCCAGGTGTTCTGACAGCATTAGTTGGTGTGAGTGGAGCTGGGAAAACCACTCTAATGGATGTCCTGGCAGGAAGGAAAACTAGTGGGTCTATTGAAGGAAGTATCACCCTCTCTGGTTACCCTAAAAAACAAGAAACTTTTGCCCGCATCAGTGGCTATTGTGAACAGACTGATATCCATTCACCAAATGTTACTGTCTATGAATCCATACTCTACTCTGCCTGGCTGCGTCTTTCCTCAGATGTTGACGAAAAAACGAGAAAGATATTTGTGGAGGAAGTCATGACTCTTGTAGAGCTTGATGTGTTGCGTAATGCTATGGTTGGTCTTCCTGGAGTGGACGGGTTATCCACTGAACAAAGAAAGAGACTGACAATTGCCGTGGAGCTGGTAGCAAATCCTTCAATCATATTCATGGATGAGCCAACTTCTGGTCTTGATGCTAGAGCCGCGGCGATTGTAATGCGGGCGGTGAGAAATACAGTTAACACTGGGCGAACTGTGGTTTGCACAATTCATCAACCCAGCATCGATATATTCGAGTCTTTTGATGAGCTTCTGCTTATGAAAAGAGGCGGACGGGTTATTTATGCTGGTGAACTTGGTCGCCACTCTCATAAAATAGTTGAATATTTTGAGGCAATTCCAGGTGTTGAAAAGATCACAGAAGGATATAATCCTGCAACATGGATGCTGGAAGTTAGCTCCCCTTCAGCCGAGGCTCGCCTGAACATAAATTTTGCTGACATTTATGCTAATTCTGACCTTTATAGGAAAAACCAAGAACTTATTAAGGAATTAAGCGTTCCCCCGCCAGGTTACGAGGATCTCTCATTTCCTACAAAGTATTCTCAGAATTTCTACAACCAATGTGTTGCAAACTTCTGGAAGCAATACAAATCTTATTGGAAGAATCCAGCTCACAACGCCATGCGCTTCCTTATGACGTTGATCTATGCCCTTGTATTTGGCACGGTTTTTTGGCAGAAGGGGACAAAAATAAACTCGCAACAAGATTTAGCCAATCTACTTGGAGCCACTTATGCTGCGGTCTTTTTCCTTGGGTCTGCCAACTGTATCACAGTTCAGCCTGTTGTGGCAATTGAGCGAACAGTTTTCTACCGTGAAAAGGCGGCAGGGATGTACTCTCCATTAGCCTATGCATTCACTCAGACATGCGTGGAGGTGATGTACAACATCGTGCAGGGGATTGAATACACGTTGATCATCTATTCGATGATTGGATATGAATGGAAAGCTGCAAAGTTCTTCTATTTCCTCTTCTTCATAATTTCCTGCTTCAACTACTTCACATTGTTTGGCATGATGCTGGTGGCGTTGAGCTCATCTGCCATGCTCGCAAACATAATCATAGCCTTTGTACTCCCCCTGTGGAACCTTTTTTCTGGATTCCTCGTTATGAGACCGTTAATACCAATTTGGTGGAGGTGGTACTACTGGGCAAACCCCGTGTCCTGGACCATATATGGCGTCATCGGGTCGCAGTTTGGCGATAACACCAGCCCAGTGTCGGTCACCGGTGGGAGCCTCGTGGTGGTGAAGCAATTCTTGGAGGACGGTATGGGCATTAAGCACGATTTCCTTGGGTATGTCGTGCTCGCGCATTTCGCGTACGTCATCGGCTTCTTCTTGGTGTTTGCTTACTCCATCAAGGTGTTGAACTTCCAGAAACGTTAGGAATGCAGGCGTCCCAATCCATAGTTTGTGTGTATATCTGTATAGTAGGATACATACGTAGGCATTGTTGCATAAACTCTGCTATTTAGAGTTTGTAGTGATATGCCGGCCCTATTTTTTAACGTTCATTTTTGGTCTGTCGGTTGTTGTCAAAGTGTAATTTGGTTCATTTTTTGTCTAATAAATATACTGTGACCCTTGTGTAGaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.63119 translated coding region predicted by ESTScan from UniGene Ta.63119

MELASGRGSRRSASAASWGSRRSFSIHSQAADPFGRAASQQGHHDDEENLRWAALEKLPTYDRMRRAVVHGGAAVDGHENTEMEGLVDINRLASGEAGRALLERVFQDDSERFLRRLRDRVDRVGIDLPAIEVRYQGLSVQVDAFVGSRALPTLWNSATNFLQGLVGRLASSNKKTIHILQNVNGIIKPSRMTLLLGPPSSGKSTLMRALTGKLDKSLKVSGNITYCGHTFEEFYPERTSVYVSQYDLHNAEMTVRETLDFSRRCLGVGARYDMLSELAAREREAGIKPDPEIDAYMKATAVQGQESNIVTDLTLKVLGLDICADMPIGDDMIRGISGGQKKRVTTGEMLTGPARALFMDEISTGLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRDNILEFFEAAGFRCPERKGVADFLQEVTSKKDQQQYWYLDQEQYRHVSVPEFAERFKSFHVGQQMLKELQIPFDKSQTHPAALTTSKYGQSSWESFKTVMSRELLLMKRNSFIYIFKVTQLLILGLVAMTVFFRTKMPYGQISDSAKFFGALTFSLITVLFNGFAELQFTIKMLPTFYKQRDFLFFPPWTFGLVNIISKVPVSLVESSVWVILTYYVMGFAPAAGRFFRQLLAFFLTHQMAMGLFRFLGAVLKSMVVANTLGMFVILIIFIFGGFVIPRGDIQPWWIWAYWSSPMMYSQNAISVNEFLSSRWANPNNDTSIAARTVGEAILKSRGLFTGDSGFWVSIGAIVGFAILFNILYLLALTYLSFGSSSNTVSDEENENETNTSMPIDEATNRPTRSQITLPFQPLSLSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGRVIYAGELGRHSHKIVEYFEAIPGVEKITEGYNPATWMLEVSSPSAEARLNINFADIYANSDLYRKNQELIKELSVPPPGYEDLSFPTKYSQNFYNQCVANFWKQYKSYWKNPAHNAMRFLMTLIYALVFGTVFWQKGTKINSQQDLANLLGATYAAVFFLGSANCITVQPVVAIERTVFYREKAAGMYSPLAYAFTQTCVEVMYNIVQGIEYTLIIYSMIGYEWKAAKFFYFLFFIISCFNYFTLFGMMLVALSSSAMLANIIIAFVLPLWNLFSGFLVMRPLIPIWWRWYYWANPVSWTIYGVIGSQFGDNTSPVSVTGGSLVVVKQFLEDGMGIKHDFLGYVVLAHFAYVIGFFLVFAYSIKVLNFQKR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50893
IPR003439
160-437 ABC_TRANSPORTER_2
ABC transporter-like

NFLQGLVGRLASSNKKTIHILQNVNGIIKPSRMTLLLGPPSSGKSTLMRALTGKLDKSLKVSGNITYCGHTFEEFYPERTSVYVSQYDLHNAEMTVRETLDFSRRCLGVGARYDMLSELAAREREAGIKPDPEIDAYMKATAVQGQESNIVTDLTLKVLGLDICADMPIGDDMIRGISGGQKKRVTTGEMLTGPARALFMDEISTGLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRDNILEFFEAAGFRCPE

Gene3D: G3DSA:3.40.50.300
177-426 G3DSA:3.40.50.300

IHILQNVNGIIKPSRMTLLLGPPSSGKSTLMRALTGKLDKSLKVSGNITYCGHTFEEFYPERTSVYVSQYDLHNAEMTVRETLDFSRRCLGVGARYDMLSELAAREREAGIKPDPEIDAYMKATAVQGQESNIVTDLTLKVLGLDICADMPIGDDMIRGISGGQKKRVTTGEMLTGPARALFMDEISTGLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRDNILE

superfamily: SSF52540
177-441 SSF52540

IHILQNVNGIIKPSRMTLLLGPPSSGKSTLMRALTGKLDKSLKVSGNITYCGHTFEEFYPERTSVYVSQYDLHNAEMTVRETLDFSRRCLGVGARYDMLSELAAREREAGIKPDPEIDAYMKATAVQGQESNIVTDLTLKVLGLDICADMPIGDDMIRGISGGQKKRVTTGEMLTGPARALFMDEISTGLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRDNILEFFEAAGFRCPERKGV

HMMSmart: SM00382
IPR003593
189-422 AAA,NBS
ATPase, AAA+ type, core

PSRMTLLLGPPSSGKSTLMRALTGKLDKSLKVSGNITYCGHTFEEFYPERTSVYVSQYDLHNAEMTVRETLDFSRRCLGVGARYDMLSELAAREREAGIKPDPEIDAYMKATAVQGQESNIVTDLTLKVLGLDICADMPIGDDMIRGISGGQKKRVTTGEMLTGPARALFMDEISTGLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRD

HMMPfam: PF00005
IPR003439
204-361 ABC_tran
ABC transporter-like

STLMRALTGKLDKSLKVSGNITYCGHTFEEFYPERTSVYVSQYDLHNAEMTVRETLDFSRRCLGVGARYDMLSELAAREREAGIKPDPEIDAYMKATAVQGQESNIVTDLTLKVLGLDICADMPIGDDMIRGISGGQKKRVTTGEMLTGPARALFMDE

HMMPanther: PTHR19241:SF10
365-1435 PTHR19241:SF10,ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRDNILEFFEAAGFRCPERKGVADFLQEVTSKKDQQQYWYLDQEQYRHVSVPEFAERFKSFHVGQQMLKELQIPFDKSQTHPAALTTSKYGQSSWESFKTVMSRELLLMKRNSFIYIFKVTQLLILGLVAMTVFFRTKMPYGQISDSAKFFGALTFSLITVLFNGFAELQFTIKMLPTFYKQRDFLFFPPWTFGLVNIISKVPVSLVESSVWVILTYYVMGFAPAAGRFFRQLLAFFLTHQMAMGLFRFLGAVLKSMVVANTLGMFVILIIFIFGGFVIPRGDIQPWWIWAYWSSPMMYSQNAISVNEFLSSRWANPNNDTSIAARTVGEAILKSRGLFTGDSGFWVSIGAIVGFAILFNILYLLALTYLSFGSSSNTVSDEENENETNTSMPIDEATNRPTRSQITLPFQPLSLSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGRVIYAGELGRHSHKIVEYFEAIPGVEKITEGYNPATWMLEVSSPSAEARLNINFADIYANSDLYRKNQELIKELSVPPPGYEDLSFPTKYSQNFYNQCVANFWKQYKSYWKNPAHNAMRFLMTLIYALVFGTVFWQKGTKINSQQDLANLLGATYAAVFFLGSANCITVQPVVAIERTVFYREKAAGMYSPLAYAFTQTCVEVMYNIVQGIEYTLIIYSMIGYEWKAAKFFYFLFFIISCFNYFTLFGMMLVALSSSAMLANIIIAFVLPLWNLFSGFLVMRPLIPIWWRWYYWANPVSWTIYGVIGSQFGDNTSPVSVTGGSLVVVKQFLEDGMGIKHDFLGYVVLAHFAYVIGFFLVFAYSIKVLNFQKR

HMMPanther: PTHR19241
365-1435 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

GLDSSSTFQIVKYIGQLVHVMNETVMISLLQPPPETYNLFDDIILLSEGYIVYHGPRDNILEFFEAAGFRCPERKGVADFLQEVTSKKDQQQYWYLDQEQYRHVSVPEFAERFKSFHVGQQMLKELQIPFDKSQTHPAALTTSKYGQSSWESFKTVMSRELLLMKRNSFIYIFKVTQLLILGLVAMTVFFRTKMPYGQISDSAKFFGALTFSLITVLFNGFAELQFTIKMLPTFYKQRDFLFFPPWTFGLVNIISKVPVSLVESSVWVILTYYVMGFAPAAGRFFRQLLAFFLTHQMAMGLFRFLGAVLKSMVVANTLGMFVILIIFIFGGFVIPRGDIQPWWIWAYWSSPMMYSQNAISVNEFLSSRWANPNNDTSIAARTVGEAILKSRGLFTGDSGFWVSIGAIVGFAILFNILYLLALTYLSFGSSSNTVSDEENENETNTSMPIDEATNRPTRSQITLPFQPLSLSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGRVIYAGELGRHSHKIVEYFEAIPGVEKITEGYNPATWMLEVSSPSAEARLNINFADIYANSDLYRKNQELIKELSVPPPGYEDLSFPTKYSQNFYNQCVANFWKQYKSYWKNPAHNAMRFLMTLIYALVFGTVFWQKGTKINSQQDLANLLGATYAAVFFLGSANCITVQPVVAIERTVFYREKAAGMYSPLAYAFTQTCVEVMYNIVQGIEYTLIIYSMIGYEWKAAKFFYFLFFIISCFNYFTLFGMMLVALSSSAMLANIIIAFVLPLWNLFSGFLVMRPLIPIWWRWYYWANPVSWTIYGVIGSQFGDNTSPVSVTGGSLVVVKQFLEDGMGIKHDFLGYVVLAHFAYVIGFFLVFAYSIKVLNFQKR

HMMPfam: PF01061
IPR013525
516-728 ABC2_membrane
ABC-2 type transporter

SFKTVMSRELLLMKRNSFIYIFKVTQLLILGLVAMTVFFRTKMPYGQISDSAKFFGALTFSLITVLFNGFAELQFTIKMLPTFYKQRDFLFFPPWTFGLVNIISKVPVSLVESSVWVILTYYVMGFAPAAGRFFRQLLAFFLTHQMAMGLFRFLGAVLKSMVVANTLGMFVILIIFIFGGFVIPRGDIQPWWIWAYWSSPMMYSQNAISVNEF

HMMPfam: PF08370
IPR013581
733-796 PDR_assoc
Plant PDR ABC transporter associated

WANPNNDTSIAARTVGEAILKSRGLFTGDSGFWVSIGAIVGFAILFNILYLLALTYLSFGSSSN

superfamily: SSF52540
826-1073 SSF52540

TLPFQPLSLSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGRVIYAGELGR

ProfileScan: PS50893
IPR003439
834-1087 ABC_TRANSPORTER_2
ABC transporter-like

LSFNHVNYYVDMPAEMREQGFAESRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGRVIYAGELGRHSHKIVEYFEAIPG

Gene3D: G3DSA:3.40.50.300
857-1071 G3DSA:3.40.50.300

SRLQLLSDISGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGGRVIYAGEL

HMMSmart: SM00382
IPR003593
871-1063 AAA,NBS
ATPase, AAA+ type, core

PGVLTALVGVSGAGKTTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVNTGRTVVCTIHQPSIDIFESFDELLLMKRGG

HMMPfam: PF00005
IPR003439
886-1014 ABC_tran
ABC transporter-like

TTLMDVLAGRKTSGSIEGSITLSGYPKKQETFARISGYCEQTDIHSPNVTVYESILYSAWLRLSSDVDEKTRKIFVEEVMTLVELDVLRNAMVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTS

HMMPfam: PF01061
IPR013525
1160-1373 ABC2_membrane
ABC-2 type transporter

QCVANFWKQYKSYWKNPAHNAMRFLMTLIYALVFGTVFWQKGTKINSQQDLANLLGATYAAVFFLGSANCITVQPVVAIERTVFYREKAAGMYSPLAYAFTQTCVEVMYNIVQGIEYTLIIYSMIGYEWKAAKFFYFLFFIISCFNYFTLFGMMLVALSSSAMLANIIIAFVLPLWNLFSGFLVMRPLIPIWWRWYYWANPVSWTIYGVIGSQF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox