PRGDB00078050 (Ta.67237)

From PRG Wiki
Jump to: navigation, search
Ta.67237
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241986968 (AK334229)
Gene Class N
Domain Type NBS, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT009_K22, cultivar: Chinese Spring

DNA Sequence

GGCGATCACATCCAAACAGAAGCAAGGGGATTTTATCATGGCGGAGCTCATCATCTCGGCGGTTGTCGGGGACATGGTCGGTAGGGTGATATCTCTTCTCGCTGGCCGGTTCAAAGGCCAAGGGTGCACCGAAGCCAAGCTACGGAGGATTTGCCATATGCTTGTCAAGGTTCACAGTGCGGTAGAGGAGGCCAAAGGGGGGCAGATCACAAACTACGGTACCCTCGAGTGGCTTTCAGAACTCAGCGACAGTGTGTACCAGGGCCGCTACTTGCTCGACACGGTCGGATGCAGAGAGGAGTTTGAAGATGAGCATGCTGACAAGGTAGTTGCACAACTTTTCTCTTTCTCCTTGCTTAATCCTGCAAAGCGTGTGCGCTTAGCGGCAGGTGCCGTGAAGAGCCTATTGTCTCGCCAAGATGTTGGTGTTCCTGAGATAGATAGAGTGGTAGAGATCTTAGAGGTCGTATCCGGTGATCTCAAGGAGTTCCTGATGCTCCTACAGAACTGTCAGCCGATCCAACGCCCTTTGGCTACTAATATCTTTGTCGAGGGGCAGATGTTCGGTCGACATGTCGAGAAAGAGAGGATCATCAACTTCCTACTGCATGATGGTGGTCCATCAACTGGGGGGAAACTGGGTGTGCTCCCGATTGTTGGCAGCATGGGAGTCGGGAAGACCACCCTTGCGCAGCATGTCTGCGATGATGAGAGGGTGCGCAACCACTTCCCAATAATTTTGTATTCCAATTTCTCATACACCAGAGCAATGGCTCGGGATGAGGCGGTGTTTGTTCTTGGATCCAAACACACAGTTGGAGATGCTCAAAAATTCATCGAGTCACTACATGTACTTAAGGAGAAATGCCTCACCAAGAGGTTCTTGATGGTATTTGAAGATGTTGACATGGGCAAAAAACAGATGCTAGAAGAGTTACTGCCAATCTTGAGACATGGCAAATTCGGGAGCAGGATCATAATCACCACAAACAACGGGGATGTCGCCAGCTTGGGAACTGTGCAGCCAATCAATCTGAAGGTTATGCCGCATCAGGAGTACTGGTTCTTCTTCAAGGCACACGCGTTTGCTGGCAGAGATGTCGAGGAGGACCCAAGGATGCTAGCAGCAGGCAAGGTGATTGCGAGGAAGCTAAATGGGTCCTTCTTCGGAGCAAAAATCATCGGTGGGGTGCTGAAAGCTCATCCGAATCCCCGGTTCTGGAGCAAGGTGCTGAGGAGCAATATAGGGGGGTTGTCTCTGCTGGGCGATGGAATTGGGTACATTGGAGATTTGGCAGAAAATTTGCTACCAATCTACGCAGACGTGTGTAAGGTGACCCTTTCTAGGAGTCCATTTATCTTTCAGACAGAACTGGCTAGGTTGGAGGATCTGTATCAGGCAAGTCCGCTTGGTGATATCCGATTTGGAAAAATTCTGTTGTGCATGTCAACGTTGCCATTCCAACTCCTGAACTACACTGCTGATTGCAATGTGCGCGGACCGGACTATGCAGCAGAGTTCATAAAAATTTAATGAAGTAGGGATGTGAAGATTAGACAGGAGCTACGCCTGTTTATACGGAATCTGATGCACCCATCCCCATGGAATTGACTGCTCCGTGCAGAGCTGGATGCTCTGTTTTGAGTTGTATTATTGTTGTTTCTCTTGTCTAGCTTCGCTGGTATATACATGAAACTAGCTCCAATAACTGTAACATCTTGATGTAtactccctccgttcctaaatacttgtctttctaggcatttcaacaagtgactacatacggagcaaaatgagtgaatctacactctaaaataaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.67237 translated coding region predicted by ESTScan from UniGene Ta.67237

XAITSKQKQGDFIMAELIISAVVGDMVGRVISLLAGRFKGQGCTEAKLRRICHMLVKVHSAVEEAKGGQITNYGTLEWLSELSDSVYQGRYLLDTVGCREEFEDEHADKVVAQLFSFSLLNPAKRVRLAAGAVKSLLSRQDVGVPEIDRVVEILEVVSGDLKEFLMLLQNCQPIQRPLATNIFVEGQMFGRHVEKERIINFLLHDGGPSTGGKLGVLPIVGSMGVGKTTLAQHVCDDERVRNHFPIILYSNFSYTRAMARDEAVFVLGSKHTVGDAQKFIESLHVLKEKCLTKRFLMVFEDVDMGKKQMLEELLPILRHGKFGSRIIITTNNGDVASLGTVQPINLKVMPHQEYWFFFKAHAFAGRDVEEDPRMLAAGKVIARKLNGSFFGAKIIGGVLKAHPNPRFWSKVLRSNIGGLSLLGDGIGYIGDLAENLLPIYADVCKVTLSRSPFIFQTELARLEDLYQASPLGDIRFGKILLCMSTLPFQLLNYTADCNVRGPDYAAEFIKI

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
171-364 P-loop containing nucleoside triphosphate hydrolases

CQPIQRPLATNIFVEGQMFGRHVEKERIINFLLHDGGPSTGGKLGVLPIVGSMGVGKTTLAQHVCDDERVRNHFPIILYSNFSYTRAMARDEAVFVLGSKHTVGDAQKFIESLHVLKEKCLTKRFLMVFEDVDMGKKQMLEELLPILRHGKFGSRIIITTNNGDVASLGTVQPINLKVMPHQEYWFFFKAHAFA

Gene3D: G3DSA:3.40.50.300
188-333 no description

MFGRHVEKERIINFLLHDGGPSTGGKLGVLPIVGSMGVGKTTLAQHVCDDERVRNHFPIILYSNFSYTRAMARDEAVFVLGSKHTVGDAQKFIESLHVLKEKCLTKRFLMVFEDVDMGKKQMLEELLPILRHGKFGSRIIITTNNG

HMMPfam: PF00931
IPR002182
194-414 NB-ARC,NBS
NB-ARC

EKERIINFLLHDGGPSTGGKLGVLPIVGSMGVGKTTLAQHVCDDERVRNHFPIILYSNFSYTRAMARDEAVFVLGSKHTVGDAQKFIESLHVLKEKCLTKRFLMVFEDVDMGKKQMLEELLPILRHGKFGSRIIITTNNGDVASLGTVQPINLKVMPHQEYWFFFKAHAFAGRDVEEDPRMLAAGKVIARKLNGSFFGAKIIGGVLKAHPNPRFWSKVLRS

FPrintScan: PR00364
IPR000767
216-231 DISEASERSIST
Disease resistance protein

VLPIVGSMGVGKTTLA

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

KCLTKRFLMVFEDVD

Seg: seg
416-432 seg

IGGLSLLGDGIGYIGDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox