PRGDB00078085 (Ta.68035)

From PRG Wiki
Jump to: navigation, search
Ta.68035
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39572928 (CK210538)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

FGAS022359 Triticum aestivum FGAS: Library 5 GATE 7 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

TCGCTCGCATTCTNCGACCCACGCGTCCGCTCTTGGTCATTTATGTGCTTCGATGGTACCTCTTCTTTTGATTCTCATGTTAGCAAAAAAGACAAGGCCAATTGAACTAGAAAGACGCATGGCTCCAGTGCATCATCACTTTTTCATGGTCTGCTTGTTGGTGCCCAAGTTGATCTGCCTCTGGGTGCCCAAGATACAGGTTAGTGTCAACATTTGCGAACTCGGCATTCTGATGTGGGAGTTTGGTGCTTGTTCTGTTAATCAGGCAAAGATCTCTGATCAGCGAGCAGTGTTAGAAACCCCAATTCGTGCTTGGGAGATAGTGTCGCGAATTCATGGCCTTTGGGGGATGGACATTTACAAGAATAAGGTGCATCAGTTTTTACAGAGTGTGCGGCAGGATGAGTCTTTTTTTGGATTATGGGGCACGCCGGGTGTTGGCAAGACACGACTTCTTTCACTCATTGCTGCTAGCTATGCCGATTCATTCCGTCACATATTATTTCTTGATGGTGGCAGTAGTGTGAGAGTTATGCAACATCATCTTGCTTCTTTATTGAAATTGGATTGGGAGAAGATGTCGTCGTTACCGGAGCATCGCCGAGCTAAGATCATCACTGAGTTTCTAGTGCAAGACAGTTTTTTGCTTCTATTAGACAACGTGCATGATAGACCCTACCCAGACTTGGTAGCTGTTGGTTTGCCGATTCCTCTTGGGTGTCATCAGAAGGTTGTTTTTACATCGAGGAACCAGATGATGTGTGAACGCATGGGATGCCCGATATCAAATATNATGCAGATGAAGTGCCTCGGGAACGAAGATGCTTGGAGACTTTTCAAGTACCACGCGGGGAGTCAAATCACAGAAGCTGATGCTGAAATTTACGATTATGCAAAACAGATGGTTTCTTCATGTCGGGGGTAACTTAGAGCCATATTTGCCATTGGCAAAAGGTGTGCTCAAGTGACTTGTGGTGGTAAAAATCTATTGCTTGGGAGGTCGCCTAAAAGCAAACATGGGCAGAAATTTAATCCGGACCAATTGGAAAACTAACCTTGGTTCTGATTAAGCAACTTGTGCGGTGCCTCTAGGGCTGGGAAATTGGGTGGGCTTCATTTCTGTTTGTGCCGAAA


Protein sequences

Name Description Sequence
Ta.68035 translated coding region predicted by ESTScan from UniGene Ta.68035

XRSHSXTHASALGHLCASMVPLLLILMLAKKTRPIELERRMAPVHHHFFMVCLLVPKLICLWVPKIQVSVNICELGILMWEFGACSVNQAKISDQRAVLETPIRAWEIVSRIHGLWGMDIYKNKVHQFLQSVRQDESFFGLWGTPGVGKTRLLSLIAASYADSFRHILFLDGGSSVRVMQHHLASLLKLDWEKMSSLPEHRRAKIITEFLVQDSFLLLLDNVHDRPYPDLVAVGLPIPLGCHQKVVFTSRNQMMCERMGCPISNXMQMKCLGNEDAWRLFKYHAGSQITEADAEIYDYAKQMVSSCRGXLRAIFAIGKRCAQVTCGGKNLLLGRSPKSKHGQKFNPDQLEN

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
98-334 P-loop containing nucleoside triphosphate hydrolases

VLETPIRAWEIVSRIHGLWGMDIYKNKVHQFLQSVRQDESFFGLWGTPGVGKTRLLSLIAASYADSFRHILFLDGGSSVRVMQHHLASLLKLDWEKMSSLPEHRRAKIITEFLVQDSFLLLLDNVHDRPYPDLVAVGLPIPLGCHQKVVFTSRNQMMCERMGCPISNXMQMKCLGNEDAWRLFKYHAGSQITEADAEIYDYAKQMVSSCRGXLRAIFAIGKRCAQVTCGGKNLLLGR

HMMPfam: PF00931
IPR002182
122-317 NB-ARC,NBS
NB-ARC

KNKVHQFLQSVRQDESFFGLWGTPGVGKTRLLSLIAASYADSFRHILFLDGGSSVRVMQHHLASLLKLDWEKMSSLPEHRRAKIITEFLVQDSFLLLLDNVHDRPYPDLVAVGLPIPLGCHQKVVFTSRNQMMCERMGCPISNXMQMKCLGNEDAWRLFKYHAGSQITEADAEIYDYAKQMVSSCRGXLRAIFAIG

Gene3D: G3DSA:3.40.50.300
123-225 no description

NKVHQFLQSVRQDESFFGLWGTPGVGKTRLLSLIAASYADSFRHILFLDGGSSVRVMQHHLASLLKLDWEKMSSLPEHRRAKIITEFLVQDSFLLLLDNVHDR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox