PRGDB00078088 (Ta.68139)

From PRG Wiki
Jump to: navigation, search
Ta.68139
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 141664389 (CJ779759)
Gene Class Mlo-like
Domain Type MLO
Gene Species Triticum aestivum

Comment?

CJ779759 Y. Ogihara unpublished cDNA library, whatl Triticum aestivum cDNA clone whatl2i08 5', mRNA sequence

DNA Sequence

ccccctccccacccccgccccgccgcgcccAGCCACCTATCGGAGACAAACTGCTGCCGTGCCACCGCTATAATAAGCTACAGGACGCGGCGCCCCTCCCCCAGCCCAGCTCCTTCCAGTACTTTCTCTAACGTCTCTCTCTCTTTCCTCCGTCGCCGTCGCGGAGGGTGTGGGGGGCGGATCATGGCGGAGCACGGCGAGGAGGAGGCGGCGACGCTCGAGTTCACGCCCACGTGGATCGTCGCGCTCGTCTGCTCCATCATCGTGCTCATCTCCCTCCTCGCCGAGCGATGCCTCCACTACCTCGGCAAGACCTTCAAGCGGAAGAACCAGAAGCCGCTCTACGAGGCCATCCTCAAGGTCAAAGAAGAGCTGATGCTTCTCGGGTTCATCTCGCTGCTGCTGACGGTGTGCCAAGGGAAGATTCAGAACATCTGCATTCGTCCTAGCTGGACACTCCACATGCTGCCATGCCAAGGGGAGGACGAGGTTCGGGCCGGTGAGGCGGCGCCGACAAAGGAGCATCTTGTTACATCCCAGATCATCGGCAGAATCGGGAGGCGGCTGCTCAGCGGCGGCGCGGCGGAAGTCGACGTCTGCCGGTCGAAGGGAAAAGCTCCGCTGATGTCCCTAGAAGCTATACATCAGTTGCATATTTTCATATTTGTGCTGGCTATTACACATGTTGTG


Protein sequences

Name Description Sequence
Ta.68139 translated coding region predicted by ESTScan from UniGene Ta.68139

MAEHGEEEAATLEFTPTWIVALVCSIIVLISLLAERCLHYLGKTFKRKNQKPLYEAILKVKEELMLLGFISLLLTVCQGKIQNICIRPSWTLHMLPCQGEDEVRAGEAAPTKEHLVTSQIIGRIGRRLLSGGAAEVDVCRSKGKAPLMSLEAIHQLHIFIFVLAITHVV

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
9-169 Mlo
Mlo-related protein

AATLEFTPTWIVALVCSIIVLISLLAERCLHYLGKTFKRKNQKPLYEAILKVKEELMLLGFISLLLTVCQGKIQNICIRPSWTLHMLPCQGEDEVRAGEAAPTKEHLVTSQIIGRIGRRLLSGGAAEVDVCRSKGKAPLMSLEAIHQLHIFIFVLAITHVV

Seg: seg
19-34 seg

IVALVCSIIVLISLLA

Seg: seg
120-132 seg

IIGRIGRRLLSGG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox