PRGDB00078090 (Ta.68218)

From PRG Wiki
Jump to: navigation, search
Ta.68218
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241990794 (AK330950)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: SET5_L09, cultivar: Chinese Spring

DNA Sequence

GAAGCTCACACTCCCATGGCCATGCATGTACACCCACCGAGCAAGCCAAACTAAGCTCAGCCAAGCCCAATCATCCAAGCTTCACTTAAGCAGACGCCAACGCAAACGATAAAGCCAGCGACCACGAAGCTCATCGTCTTCCATGCATCCGGCAGGTGAAGCACCACCTTTACTAGCGACCATCCAGGAAGACGACGAGCTGGCGAGCGAATCCATGAAGAGCGGCGGCGGGGTAGAAAGCTGCAGGTGCGAGGTGGAGGCCGTGGGCATCAACTACCACATCACCGTCTCCGCCCGGCCTCACCCGCTCAAGATATGGAGCAGGCCCGACGACCTCCTCCTcgacgccgccggcgaccccgctgcgcctgcgcctccgccggtcagccgcagcagccgGTGCCGCCTCGTGCTCCGCAACGTCAGCTGCCGCGCCCGCCCTGGCGAGCTGCTCGCCATCGTCGGCCCCAGCGGCGCCGGCAAGTCCACGCTGCTCGAGATCCTCTCCGGCCGCCTTGAGCCCAGCTCGTCCAGTCCTACTGACCTCCGCGTCAATGGCTCCCCTGTCGACGCCGCCGCCCTGCGCCGCCTCTGCGGCTACGTCACCCAGCGCGACGTCCTCTTCCCGCTGCTTACCGTGCGCGAGACGCTCCATTTCAGCGCGCGCCTCCGCCTCGGCCCAGACGCGTACGACGCCGCCGCGGTTGACGCGCTCGTCGACGACCTCGCCCTGGCCCGCGTCGCCGACGCCAGGGTCAAGGACCTCTCCGGAGGCGAGCGGCGCCGCGTGTCCATCGGTGTCGAGGCCGTGCGCGACCCCGCCGTGCTGGTGCTCGACGAGCCCACCTCCGGCCTCGACAGCGCGTCCGCGCTCCAGATCGTCGGCGCGCTGCGGGCAATGGCCGAGTCGCGGGGCCGCACCGTGGTGCTCAGCATCCACCAGCCCGGCGCGCGCATTGTCAAGATGTTCGACGCCGTGCTCCTGCTCGCCGCGGGCTCCGTGCTCCACCACGGCTCCGTCGACGAGCTCCACGCCCTGCTCACCGGCGCCGGCCTCCGCCTGCCCCCGCACGTGGACGCCGTCGAGTTCGCCATCGACTCCGTGGACGAGCTCCGCCTCCACCTCCACCTCcagcagcagcagcagcGCGACCGCCGGTGCACGCTGCAGCAGCTCTTCCAGCAGCACAAGCTCCAGGCCCAAGCCGAGGACGACTCCTCCAGCACGCTCGCCGCCGGTGGAAACAGCAATGGGCAACACCAGTACGCCAACTCGTGGCCGGTCGAGGTGGCGGTGCTGTCGCAGCGCTTCTTCAAGAACGTGGCGCGGACGCGGCAGCTCTTCGCGTGCCGCACCGTGTGCATGCTCGTCGCCGGGCTCGCCCTCGGCTCCATCTTCTACGACCTCGCCGAAGACAAGGTGGCGGAGCGGGTCGGCCTCTTCGCGTTCCTCCTCACCTTCCTGCTCTCGTCCACGACGGAGGCGCTGCCGGTGTTCCTGCAGGAGCGGGAGATCCTGGCCAAGGAGACCTCATCGGGCGCCTACCGCGTGTCCGCCTACGCAGTGGCGAACGCCCTGGTGTTCCTGCCGTTCCAGCTGGTGCTGGCGGCGGTGTTCGCGGCGCCGGCGTACTGGCTGACGGGGCTGCGCCGCACGGCGCCGGCATTCTCCTACTTCCTGCTCCTCATCTGGCTGGTCCTCTACACGGCCAACTCGGTGGTGGCGTGCTTCGCGGCGGCGGCGCCGGACTTCGTAGTGGGGAACGCGGCGGTGCAGGGCGTGATGGGCTCCTTCTTCCTCTTCTCCGGCTACTTCATCCGGCGGTCGGCGATGCCGGCGTACTGGGTGCCGATGCACTACCTGTCGCTCTTCAAGTGGCCGTTCGAGGCGCTGCTGCTGAACGAGTTCGGCGGCAAGTGCGCGGCAAGGGCGATGGGGGTGTGCGTGGCGACCGGCGACGAGGTGCTCCGGCGGGAGGGGATCGGGGAGGAGTGCCGGTGGAGGAACGTGGCGGTCATGGTCGGCTTCGTCGCCTTCTACCGGGTGCTCGGCTACGCCGTGCTCCGCGTCCGCTGCAGCCTCACGCTCAGGGCCGCCGCGCGGTCCGCATTGCTGTCTTCCTCCTCACACTACTCTGCTTGCTTCTCTGCATCTACCAGTACCAAAGCTTGAATCCGTTCCTTGCATGTGTTCTGTAGATCTTGCTATGATTTTGGTTGTAAATTATGGGACTTGTGATGAGTAGAGGGACTAATTATATTTCGTCTACATCATCCAACATGAATCACACAAGGCATTACCTACATATTATTATATGGGAAGCACTTATATTATATACAATGGATTAGCTTTAGATGTAATGGTTCCATGGCTCTAAAAGTACTCCATTTTATATAAAAAGATATTAACATCTCGTATAATGGAGAAAAATGTCCTATTAATTAACGGAAATTAAATTTGGCGAACGATCATCTTTTTTTCTTCCAAAAAATTTGTGCAGGGATCTTGGCGCAGGGCGAACGCCACGTAGATCTGCTGACGTCGTTCGCTGTAAAGTGTTCCCTAGCGAACGCTCGCTTTTTTTCTTCCAAAAAATTTGTGCAAGGTGTGCGATCAGGGAACTCAAACTCCAGACCTCCTATGGGAGACCCGCAGGCTCTACCAGTTGGACTGAAGCAGGTTCTACCAACAAGTAGGCTCAACACCTGACAGCCCAGGGGTGAGTGACAACAGCTACAAAGTCACCATTCACACAGACAGCGCTACGTCACACTGGAAAGGAAGGTCTCACAGAATTACAGTACATATTAAGGGCTCGAGGCCCAACATAGCTCGATAGCATCATATGGCGTGTTCGGCAACTCTGGTCATCATCGAAGCTCTTCGCCTTGGCTATTGGAGGGATGATCTTGTGAAGGAGATCATGTATCTCCCAAGTCCCAACAATGTTGCGGATAGGAGGAGATCCTCTGTCACCACAAGCATCAGAATGATTAGTACTAGTTCCCAAACAATTTCTAGGAAAAACAACTGGAAGCAGTCATACAGCCAAATGCATGGACTGTCGGCTATCAGTTAGTACATAGCAGTACAACAGATGTAGTTGATTACCCTGTTAATAAACATAACATCTTTATTAATGCTGTAATTCTGTAGGAAGAGATGCCATAATAAACAGTGAAATGTAGCATCAGATTGTAAAGTAAAAGATGAATGGAACAGGAGAGGaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.68218 translated coding region predicted by ESTScan from UniGene Ta.68218

XKLTLPWPCMYTHRASQTKLSQAQSSKLHLSRRQRKRXSQRPRSSSSSMHPAGEAPPLLATIQEDDELASESMKSGGGVESCRCEVEAVGINYHITVSARPHPLKIWSRPDDLLLDAAGDPAAPAPPPVSRSSRCRLVLRNVSCRARPGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGSVLHHGSVDELHALLTGAGLRLPPHVDAVEFAIXLRGRAPPPPPPPAAAAARPPVHAAAALPAAQAPGPSRGRLLQHARRRWKQQWATPVRQLVAGRGGGAVAALLQERGADAAALRVPHRVHARRRARPRLHLLRPRRRQGGGAGRPLRVPPHLPALVHDGGAAGVPAGAGDPGQGDLIGRLPRVRLRSGERPGVPAVPAGAGGGVRGAGVLADGAAPHGAGILLLPAPHLAGPLHGQLGGGVLRGGGAGLRSGERGGAGRDGLLLPLLRLLHPAVGDAGVLGADALPVALQVAVRGAAAERVRRQVRGKGDGGVRGDRRRGAPAGGDRGGVPVEERGGHGRLRRLLPGARLRRAPRPLQPHAQGRRAVRIAVFLLTLLCLLLCIYQYQSLNPFLACVL

Domains

Domain Start-End Description Sequence

Seg: seg
25-51 seg

SSKLHLSRRQRKRXSQRPRSSSSSMHP

Seg: seg
110-128 seg

PDDLLLDAAGDPAAPAPPP

ProfileScan: PS50893
IPR003439
124-357 ABC_TRANSPORTER_2
ABC transporter-like

PAPPPVSRSSRCRLVLRNVSCRARPGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGSVLHHGSVDELHALLTGAGLRLPP

Seg: seg
129-143 seg

VSRSSRCRLVLRNVS

Gene3D: G3DSA:3.40.50.300
136-345 no description

RLVLRNVSCRARPGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGSVLHHGSVDELH

HMMPanther: PTHR19241:SF101
136-366 SUBFAMILY NOT NAMED

RLVLRNVSCRARPGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGSVLHHGSVDELHALLTGAGLRLPPHVDAVEFAI

HMMPanther: PTHR19241
136-366 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

RLVLRNVSCRARPGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGSVLHHGSVDELHALLTGAGLRLPPHVDAVEFAI

superfamily: SSF52540
138-343 P-loop containing nucleoside triphosphate hydrolases

VLRNVSCRARPGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGSVLHHGSVDE

HMMSmart: SM00382
IPR003593
148-334 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGELLAIVGPSGAGKSTLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTSGLDSASALQIVGALRAMAESRGRTVVLSIHQPGARIVKMFDAVLLLAAGS

HMMPfam: PF00005
IPR003439
163-284 ABC_tran
ABC transporter-like

STLLEILSGRLEPSSSSPTDLRVNGSPVDAAALRRLCGYVTQRDVLFPLLTVRETLHFSARLRLGPDAYDAAAVDALVDDLALARVADARVKDLSGGERRRVSIGVEAVRDPAVLVLDEPTS

Seg: seg
229-253 seg

DAYDAAAVDALVDDLALARVADARV

PatternScan: PS00211
IPR017871
256-270 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGERRRVSIGVEA

Seg: seg
372-402 seg

APPPPPPPAAAAARPPVHAAAALPAAQAPGP

Seg: seg
423-440 seg

VRQLVAGRGGGAVAALLQ

Seg: seg
446-483 seg

AAALRVPHRVHARRRARPRLHLLRPRRRQGGGAGRPLR

Seg: seg
494-511 seg

DGGAAGVPAGAGDPGQGD

Seg: seg
527-551 seg

PGVPAVPAGAGGGVRGAGVLADGAA

Seg: seg
554-606 seg

GAGILLLPAPHLAGPLHGQLGGGVLRGGGAGLRSGERGGAGRDGLLLPLLRLL

Seg: seg
608-622 seg

PAVGDAGVLGADALP

Seg: seg
626-668 seg

QVAVRGAAAERVRRQVRGKGDGGVRGDRRRGAPAGGDRGGVPV

Seg: seg
671-698 seg

RGGHGRLRRLLPGARLRRAPRPLQPHAQ

Seg: seg
709-718 seg

LLTLLCLLLC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox