PRGDB00078110 (Ta.68573)

From PRG Wiki
Jump to: navigation, search
Ta.68573
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241988234 (AK335492)
Gene Class N
Domain Type NBS, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT013_A12, cultivar: Chinese Spring

DNA Sequence

GGCAATGGGGCACACCCTGCGTCTCGCACATGCTCGGTTATTTCGTTCTACTCGCCTTGCACCAATAATTTGATGGAGCTCGCTCTGCACAtttgtttttgtttttgtttttGGAGCAGAAGCTTTACTCTCTGCAGCTGCTAGATCTGGTTTCTCCTTCCTCTGGAGCTGTGAAGCAAAGCTAATGTTCGATCGATCCTCTTCTTCCTGTCCTTGCTGATCGATCCATCGGCGCAGCGCCATGCCGGCCACCGCCTTAACTGTTACCGGGTGGGGGCTGTCGCCGGTCATCAAGGAGCTCGCAGAGGTGACGAAATCCTTCCTGTATGGCCGGTATAGAAGCTTCAAGCGTTTCGTCGATGAGCGTGCTCAGCTGGAGGAGATCGTGAAGAAAGCCGAGCCCATCATGGAGAGACGGCGCGGCGTCCACGACGACGAGACGACGCGTGAGCTCATAGATGCCATCGACGAGGTGAAGGGCGTCCTGGATGCCTTTCTCTACCAGGACATCCTCCTGGCCAACTTGGCAGCGAAGTACAACAAGCTCACACAATTCGCCTACTCCGCGAGGAGAGCCGGCCGGCAGCTGGTCTACAAGGACGAGCCGTTCAGACGGCTCGAGAAGGTGTGGAAGAAGCTGCCCACAATTGATCAGAAATTGCAGCTTTTTGCTGGAGAAGCCGCCTGCGAGCCAATGGAGAAGAAGGCGACGGGCCCGCTGCCGTTGCCGGGGGATAAGCTCTTCGTTGGGTACACCAAGGAGTATGATCAGCTGATGTCAGCCTTGCTCAACGACCAGCCCAGCAGCAGCAACAACCGCCGCAACATGGATGTGGTAGCCGTGGTCGGCCCCGGCGGCTCCGGGACGACCACGATGGCTCGGCGGGCAATTAACGACCACAGAGTGGCGGAACAATTCGATTTGAAGGTATGGGTGCATGTTTCAAACACGTTCCTCAACACCCACCTGTTAGCAAAGATCTGCAAGTCCATGGAAGGAACCACATGCCAAGCAGAAGCCGGGATGCTGTTCAGCAATCTCCAGCAGATCGTTCGTGAAAGGTTCAGCTCCAAGAAGTTCCTGCTTGTGCTTGATGACGTGTGCAACAATGAATCAGACAATGACATGGGGACAAGATGAAGACTGTTAGACTATGTATAGCTTCTGTACTTATGTACGTATATTGTACGTATTGTAACACATCCATTATATATAATGAGATAAGCCACCCCTAGAGGGTTGTGCTGGTTCCCCCaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.68573 translated coding region predicted by ESTScan from UniGene Ta.68573

MPATALTVTGWGLSPVIKELAEVTKSFLYGRYRSFKRFVDERAQLEEIVKKAEPIMERRRGVHDDETTRELIDAIDEVKGVLDAFLYQDILLANLAAKYNKLTQFAYSARRAGRQLVYKDEPFRRLEKVWKKLPTIDQKLQLFAGEAACEPMEKKATGPLPLPGDKLFVGYTKEYDQLMSALLNDQPSSSNNRRNMDVVAVVGPGGSGTTTMARRAINDHRVAEQFDLKVWVHVSNTFLNTHLLAKICKSMEGTTCQAEAGMLFSNLQQIVRERFSSKKFLLVLDDVCNNESDNDMGTR

Domains

Domain Start-End Description Sequence

Seg: seg
91-102 seg

LLANLAAKYNKL

superfamily: SSF52540
149-289 P-loop containing nucleoside triphosphate hydrolases

CEPMEKKATGPLPLPGDKLFVGYTKEYDQLMSALLNDQPSSSNNRRNMDVVAVVGPGGSGTTTMARRAINDHRVAEQFDLKVWVHVSNTFLNTHLLAKICKSMEGTTCQAEAGMLFSNLQQIVRERFSSKKFLLVLDDVCN

HMMPfam: PF00931
IPR002182
191-291 NB-ARC,NBS
NB-ARC

NNRRNMDVVAVVGPGGSGTTTMARRAINDHRVAEQFDLKVWVHVSNTFLNTHLLAKICKSMEGTTCQAEAGMLFSNLQQIVRERFSSKKFLLVLDDVCNNE

FPrintScan: PR00364
IPR000767
198-213 DISEASERSIST
Disease resistance protein

VVAVVGPGGSGTTTMA

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

RFSSKKFLLVLDDVC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox