PRGDB00078127 (Ta.68824)

From PRG Wiki
Jump to: navigation, search
Ta.68824
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241983779 (AK331721)
Gene Class CN
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT002_D04, cultivar: Chinese Spring

DNA Sequence

GGAGCGAACCATTCAAAGTCATTGAGTCAGCAAATTCCCAAGTCTTTCTAGCTTAGAGCACCATCTATCTGAGCTATATCCTTCGTGGTCAAGAAGCTCCGCGAGCAGACAACCTCTGAGGAGGATCTGCAGAGGCTGCGCCAGCTGCTTCTGAGGGTAAGTGCCGTTGTTGAGGAGGCCGAGGGGCGGCGTGTCACAAACCGAGGGATGATACATCAGGCTAGCACGATGAGAGAGCAAATGTTCAGAGGGTACTACCTTCTTGACACCTTCAGGTCCAGAGAGAAGGAGGCCGATGATGAGGAGTCAGATTGAGAGCACGGTAATTGGTAGAGAAAGCAGTCAGGAGTTGAAACAGGTTGTTCTTGGCCTAGAAAGCGTGGTTGCTGATATGAAGGAGTTTGCTATATTTCTGATGAGCTACCCTCGCATGTACCAGCAACCCTATGGGGCATATTTATTTGTGGACAAGTATATGTTTTGCCGCCAAATGGAGAGGGAACAAGCCATCAGCTTCTTGCTACAAGCTGAGCCTCCAGGGAATGGAAATGTGGGCGTCCTTCCAATTGTTGGTCCTGCACGAGTTGGGAAGAGCACTCTTGCGGACCATGTTTGCAATGATGAGCGTGTGCAGAATCACTTCTCCTTGATCTTGCTCTACACTGGAAACGACCTTAAAGATGAAACAGTGACAAGTTTTAGAGATCATTGTACGATCAAGCATCAAAATATTGGCTTGGATGAAAAAAGGTTGTTGGTTGTCATTGAGCTCTTAGGGGATGTGGACAAAGGGGCATGGAAGAGGCTGCTACACTTGTATGAACTATACATGCCACATGGGAGCAAAATCATAATCACCAGCCGATCAGAGAAGACAGCCAGTCTTGGAACAACGGAAGCTGTCAGGCTAAATTATTTGTCAAAAGAAGCTTACTGGTATTTCTTCAGGACGCTCGTGTTTGGTAGCACGGATCCGGAGGAGCACCCAAAGCTAACATCCATTGCCATGGAGATAGCCCTAGAGATGCGTGAATCTTTCTTATACGCATATATCATTGCTGCCTTACTGAGAGAAAATATTAGTGCTCGGTTCTGGTGCAGGGTTCTCAGACACCTTAGGGAGCACAGGCAGAAGAATATCTTGTTGTTAGGTGAATGTCCTGTTGATGAAGAACAGCCACGGTATGTTTGGAGCATGGCCAAAAGGCGGCAAGGTTCTGAGGATATTAAGTTCTATCTGCAAGGGTGTGACCCTCAAAAAGGGCCTGCTTCTCATGGCGAGATTCCAAAGATAACAGTGATGGATCTTATATCTGGCACCTGGAGTGCTATGCCACGGGGAAAATTTGAGGTCTTGTCCTGGAGGTCTGTTATACCACCGTACTACAGCTACACAACTGTTTGTGAGTTTGTCCGGCACGAGAGTAGTACCACAGCATAGATGAAGAAGAGGAGCGCTCTTTGGCACCGTCGTGACACTGCTTTGAATTACTGGTGGTTCTCTTCTTGTCTTATGGACCATGGTTCACCAGATTGGTAGATGCGACTTCCTTGCTTTGCTGGTGTTAAAGTTGGTGTATTTAAGTTGATCTGGTTCTTGACTCGAGCTTATATGGAGTATATTGTAACTGGTACCTAATTACTGGTTGTGCTTACTTGTATGGAGCTAGGTGTTAGTACATATATGGCTCCTTAATTACCGGTTGAGCTTATATGGAGCTAGATGTTTACATAGGGCTCCTTAATTGCCGGTTGTGCTTGTAACCACTTGTGTACTCTTCATCTGAATAAACAAGCCCTTGACCaaaaaaaaaaaaaaaaCGAGA


Protein sequences

Name Description Sequence
Ta.68824 translated coding region predicted by ESTScan from UniGene Ta.68824

GANHSKSLSQQIPKSFXLRAPSIXAISFVVKKLREQTTSEEDLQRLRQLLLRVSAVVEEAEGRRVTNRGMIHQASTMREKCSEGTTFLTPSGPERRRPMMRSQIESTVIGRESSQELKQVVLGLESVVADMKEFAIFLMSYPRMYQQPYGAYLFVDKYMFCRQMEREQAISFLLQAEPPGNGNVGVLPIVGPARVGKSTLADHVCNDERVQNHFSLILLYTGNDLKDETVTSFRDHCTIKHQNIGLDEKRLLVVIELLGDVDKGAWKRLLHLYELYMPHGSKIIITSRSEKTASLGTTEAVRLNYLSKEAYWYFFRTLVFGSTDPEEHPKLTSIAMEIALEMRESFLYAYIIAALLRENISARFWCRVLRHLREHRQKNILLLGECPVDEEQPRYVWSMAKRRQGSEDIKFYLQGCDPQKGPASHGEIPKITVMDLISGTWSAMPRGKFEVLSWRSVIPPYYSYTTVCEFVRHESSTTAXMKKRSALWHRRDTALNYWWFSSCLMDHGSPDWXMRLPCFAGVKVGVFKLIWFLTRAYMEYIVTGT

Domains

Domain Start-End Description Sequence

Coil: coil
43-64 coiled-coil

LQRLRQLLLRVSAVVEEAEGRR

Seg: seg
43-52 seg

LQRLRQLLLR

superfamily: SSF52540
142-380 P-loop containing nucleoside triphosphate hydrolases

PRMYQQPYGAYLFVDKYMFCRQMEREQAISFLLQAEPPGNGNVGVLPIVGPARVGKSTLADHVCNDERVQNHFSLILLYTGNDLKDETVTSFRDHCTIKHQNIGLDEKRLLVVIELLGDVDKGAWKRLLHLYELYMPHGSKIIITSRSEKTASLGTTEAVRLNYLSKEAYWYFFRTLVFGSTDPEEHPKLTSIAMEIALEMRESFLYAYIIAALLRENISARFWCRVLRHLREHRQKNI

HMMPfam: PF00931
IPR002182
167-218 NB-ARC,NBS
NB-ARC

EQAISFLLQAEPPGNGNVGVLPIVGPARVGKSTLADHVCNDERVQNHFSLIL

HMMPfam: PF00931
IPR002182
246-378 NB-ARC,NBS
NB-ARC

LDEKRLLVVIELLGDVDKGAWKRLLHLYELYMPHGSKIIITSRSEKTASLGTTEAVRLNYLSKEAYWYFFRTLVFGSTDPEEHPKLTSIAMEIALEMRESFLYAYIIAALLRENISARFWCRVLRHLREHRQK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox