PRGDB00078130 (Tcc.179)

From PRG Wiki
Jump to: navigation, search
Tcc.179
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212321503 (CU534434)
Gene Class Unknown
Domain Type
Gene Species Theobroma cacao

Comment?

CU534434 TEGPULI_KZ0AAI_K Theobroma cacao cDNA clone KZ0AAK2YE14FM1, mRNA sequence

DNA Sequence

CGGGGATCTCATTGCCATTTGTAAATACACTTAGGTTTGTTTCCCCAGAGTTATTTGGTTTTCTCTTCTCTTTCGAAAGGTTGGATAAGGTTTCCAAAACAATGAATCATGTTCTGCATTTCATGTTTGGAATTTTTGGAAATGCCACTGCTGCGTTCCTCTTCTTGTCTCCAACGATTACATTTTGGAGGGTCATTAAAAGCAAGTCCACAGAGCAGTTCTCTGGAATTCCCTACGTGATGACCTTGCTCAACTGTCTCCTCTCCGCCTGGTATGGCCTTCCCTTTGTATCAGAAAACAACATTCTGGTTGTTACAATCAATGGGGCAGGCTCCGGACTTGAGTTCATTTATGTGTTGATCTTCATCTACCATGCACCAAAGAAGGAGAAGATTAAAGTCCTTGCGCTCTTCGGTTTTGTACTCGCTGTTTTCTCTGCTGTGGCCCTGGTCTCTGTCTTGGCCCTGCATGGTACCGGCAGAAAGGTCTTTTGCGGCGTTGTTGCTGCCGTTTTCTCTGTTGCCATGTATGCCTCACCTCTTTCAATCATGAGACTGGTGATCAAAACTAAGAGCGTGGAGTTCATGCCATTCTTCTTGTCACTATTTGTATTCCTCTGTGGTACATCATGGTTTGTTTATGGTATTCTTGGTCGTGATGCTTTTATTGCTGTCCCGAATGGTTTTGGGTGTACCCTGGGGACTATGCAGCTCATTCTTTACTCCATCTACCACAAGAAC


Protein sequences

Name Description Sequence
Tcc.179 translated coding region predicted by ESTScan from UniGene Tcc.179

MNHVLHFMFGIFGNATAAFLFLSPTITFWRVIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSENNILVVTINGAGSGLEFIYVLIFIYHAPKKEKIKVLALFGFVLAVFSAVALVSVLALHGTGRKVFCGVVAAVFSVAMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGILGRDAFIAVPNGFGCTLGTMQLILYSIYHKN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
1-210 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

MNHVLHFMFGIFGNATAAFLFLSPTITFWRVIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSENNILVVTINGAGSGLEFIYVLIFIYHAPKKEKIKVLALFGFVLAVFSAVALVSVLALHGTGRKVFCGVVAAVFSVAMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGILGRDAFIAVPNGFGCTLGTMQLILYSIY

HMMPfam: PF03083
IPR004316
8-95 MtN3_slv
RAG1-activating protein-1-related

MFGIFGNATAAFLFLSPTITFWRVIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSENNILVVTINGAGSGLEFIYVLIFIYHAPKK

Seg: seg
100-122 seg

VLALFGFVLAVFSAVALVSVLAL

HMMPfam: PF03083
IPR004316
131-212 MtN3_slv
RAG1-activating protein-1-related

CGVVAAVFSVAMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGILGRDAFIAVPNGFGCTLGTMQLILYSIYHK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox