PRGDB00078133 (Tcc.767)

From PRG Wiki
Jump to: navigation, search
Tcc.767
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212153999 (CU550757)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Theobroma cacao

Comment?

CU550757 EMBR1WI_KZ0ABA Theobroma cacao cDNA clone KZ0ABA10YA24FM1, mRNA sequence

DNA Sequence

CGGGGACCTAAAGCTGGCAATAACTGTTCTACTGTCTTTCCAGAGCCTCTTTCTCTCCCACCAGATGGTCTAAAAGCTCAATCGGACTATGGATCAAAAGGTCATCGTGTAGCTGTTGCTTTTGGTGCAAGCTTTGGTGCTGCTTTTTTCATCATACTATTTATAGGATTACTTGTTTGGTGGCGCTATAGACACAACCAGCAGATTTTCTTTGATGTCAATGAACAATATGACCCGGAAGTATGCTTGGGCCATTTGAAAAGGTATACATTTAAAGAACTTAGGGCTGCTACTGACCATTTCAACTCCAAGAACATTCTAGGGAGAGGTGGATTTGGGATAGTGTACAAGGGATGCTTGAATGATGGGACTTTGGTGGCTGTTAAAAGGCTGAAGGACTATAACATAGCTGGTGGAGAAATCCAATTTCAGACAGAAGTAGAGACAATAAGTTTAGCTGTCCATCGCAATCTACTCAGGCTTTCTGGATTCTGCACAACTGAGAATGAAAGGCTCCTGGTTTACCCCTATATGCCAAATGGAAGTGTAGCTTCTAGACTAAGAGATCACATACATGGTCGGCCAGCTTTAGACTGGGCAAGGCGGAAGAGGATAGCCTTAGGTACAGCCAGGGGGCTTGTTTATTTGCATGAACAGTGTGACCCGAAAATTATTCACCGTGATGTCAAAGCTGCCAACATTTTGTTG


Protein sequences

Name Description Sequence
Tcc.767 translated coding region predicted by ESTScan from UniGene Tcc.767

RGPKAGNNCSTVFPEPLSLPPDGLKAQSDYGSKGHRVAVAFGASFGAAFFIILFIGLLVWWRYRHNQQIFFDVNEQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF851
4-236 SUBFAMILY NOT NAMED

KAGNNCSTVFPEPLSLPPDGLKAQSDYGSKGHRVAVAFGASFGAAFFIILFIGLLVWWRYRHNQQIFFDVNEQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

HMMPanther: PTHR24420
4-236 FAMILY NOT NAMED,FAMILY NOT NAMED

KAGNNCSTVFPEPLSLPPDGLKAQSDYGSKGHRVAVAFGASFGAAFFIILFIGLLVWWRYRHNQQIFFDVNEQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

Gene3D: G3DSA:2.60.120.200
IPR013320
35-119 no description
Concanavalin A-like lectin/glucanase, subgroup

HRVAVAFGASFGAAFFIILFIGLLVWWRYRHNQQIFFDVNEQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGC

Seg: seg
37-59 seg

VAVAFGASFGAAFFIILFIGLLV

superfamily: SSF56112
IPR011009
71-236 Protein kinase-like (PK-like)
Protein kinase-like domain

FDVNEQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

ProfileScan: PS50011
IPR000719
101-236 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

HMMSmart: SM00220
IPR002290
101-236 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

HMMSmart: SM00219
IPR020635
101-236 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNSKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

HMMPfam: PF00069
IPR017442
103-236 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SKNILGRGGFGIVYKGCLNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLLVYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

PatternScan: PS00107
IPR017441
107-129 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGIVYKGCLNDGTLVAVK

Gene3D: G3DSA:3.30.200.20
120-173 no description

LNDGTLVAVKRLKDYNIAGGEIQFQTEVETISLAVHRNLLRLSGFCTTENERLL

Gene3D: G3DSA:1.10.510.10
174-236 no description

VYPYMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPKIIHRDVKAANILL

PatternScan: PS00108
IPR008271
224-236 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox