PRGDB00078134 (Tcc.833)

From PRG Wiki
Jump to: navigation, search
Tcc.833
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 213166976 (CU629726)
Gene Class Unknown
Domain Type LRR
Gene Species Theobroma cacao

Comment?

CU629726 COTYLEI_KZ0ABB Theobroma cacao cDNA clone KZ0ABB1YK07, mRNA sequence

DNA Sequence

CGGGGAAAGCCGATTCTCTTTAGAAATTTTGGTAGGAAGTAGTAGGAtctctaaaagcactcttcctctttctttctctctctcggttcttctcttcctttttacttttctAAACCATAAAGACCTAACCCTAACAGAGCAGCTGCAGCTAAAACATCACCACCACCCATGGCGGCACCGATCTGGATATGGGCTTTCTCTGTGTCCCTGACTGTGGTTCCGTTCGTTTTGGGAAACTCAGAAGGAGATGCTCTTTACACTTTGAGAAGAAGCTTAACGGATCCGGATAACGTGCTCCAGAGCTGGGATCCGACCCTTGTTAATCCTTGTACTTGGTTCCACATCACTTGTAACCAAGATAATCGAGTCACCAGAGTAGATTTAGGTAATTCAAACCTATCTGGGCATTTGGTATCTGAGCTTGGGAAGCTTGAGCATTTGCAGTATCTGGAGCTTTACAAAAATAACATCGAAGGAACCATCCCTACTGAACTCGGAAACTTGAAGAGCCTTATCAGTTTGGACCTATATAACAACAACATCTCAGGGACCATTCCTCCATCACTAGGGAAATTGAAATCTCTTGTATTCTTGAGGCTTAATGACAACTGGTTAACTGGACCTATCCCTAGGGAACTTGCTGGTATTTCAAGCCTCAAAGTTGTTGATGTCTCGAACAATGATTTGTGTGGAACCATTCCTACCAGCGGACCATTTGAGCACATTCCTTTGAACAACTTTGAGAGAAACCCTAGGCTTGAAGGTCCAGAGTTGCTGGGGCTTGCTAGTTACGACACAAACTGCTCGTGAAGGACAGCGTGATGCTGCAAAGCTTCGGATTAGATATGTACTCACAAAATTTCAAGTGTATTATCACGGTATAATGGGGTTTGTCAAATGCAGTCCCTCATATATAAGTATCTGTAAATTTGAATACCTGCTTGGCCCGTATTAGCATTTGTAACTGAATTATCCTGCTCTTCTTAAGATGTTCAAGACGACAACTAGTATTGATGTAATGGTAGTGACAAGTTTACTTCCGGTATGCATCCTTAATTTGGCTTTCTTGCCATTTTATGGTCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Tcc.833 translated coding region predicted by ESTScan from UniGene Tcc.833

MAAPIWIWAFSVSLTVVPFVLGNSEGDALYTLRRSLTDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRVDLGNSNLSGHLVSELGKLEHLQYLELYKNNIEGTIPTELGNLKSLISLDLYNNNISGTIPPSLGKLKSLVFLRLNDNWLTGPIPRELAGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFERNPRLEGPELLGLASYDTNCS


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
19-206 L domain-like,LRR

FVLGNSEGDALYTLRRSLTDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRVDLGNSNLSGHLVSELGKLEHLQYLELYKNNIEGTIPTELGNLKSLISLDLYNNNISGTIPPSLGKLKSLVFLRLNDNWLTGPIPRELAGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFERNPRLEGPELLGLA

HMMPanther: PTHR24420:SF836
23-201 SUBFAMILY NOT NAMED

NSEGDALYTLRRSLTDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRVDLGNSNLSGHLVSELGKLEHLQYLELYKNNIEGTIPTELGNLKSLISLDLYNNNISGTIPPSLGKLKSLVFLRLNDNWLTGPIPRELAGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFERNPRLEGPE

HMMPanther: PTHR24420
23-201 FAMILY NOT NAMED,FAMILY NOT NAMED

NSEGDALYTLRRSLTDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRVDLGNSNLSGHLVSELGKLEHLQYLELYKNNIEGTIPTELGNLKSLISLDLYNNNISGTIPPSLGKLKSLVFLRLNDNWLTGPIPRELAGISSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFERNPRLEGPE

HMMPfam: PF08263
IPR013210
23-62 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGDALYTLRRSLTDPDNVLQSWDPTLVNPCTWFHITCN

Gene3D: G3DSA:3.80.10.10
24-180 no description

SEGDALYTLRRSLTDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRVDLGNSNLSGHLVSELGKLEHLQYLELYKNNIEGTIPTELGNLKSLISLDLYNNNISGTIPPSLGKLKSLVFLRLNDNWLTGPIPRELAGISSLKVVDVSNNDLCGTIPTS

HMMPfam: PF12799
90-126 LRR_4,Leucine Rich repeats (2 copies)

HLQYLELYKNNIEGTIPTELGNLKSLISLDLYNNNIS

HMMPfam: PF00560
IPR001611
162-180 LRR_1
Leucine-rich repeat

SLKVVDVSNNDLCGTIPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox