PRGDB00078135 (Tcc.1119)

From PRG Wiki
Jump to: navigation, search
Tcc.1119
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212108051 (CU478179)
Gene Class Unknown
Domain Type
Gene Species Theobroma cacao

Comment?

CU478179 COPHAS_KZ0AAL Theobroma cacao cDNA clone KZ0AAL8YD13FM1, mRNA sequence

DNA Sequence

CGGGGATTCCAACAACTACCTCTCCCCACACCCATCTACTCTCCCACGCCCTTTGAATGCTAGGCCAAGCCAACCCCCTTCCTTCTTTATATTCTCGTCTCTACCATTTCAGGTCGACCCCAGAGCTTTTATTAGCACTACGTTTAACTCTTTCGATCAAATATAAACTAAATTTAACTCACCAGTCTGACTCTTTTTGCATCTTATCTCCCGAAGAAAGGAATGGCACCGGCTTCTTTCCATCACGAGAAAGTTTGCGTGATGGATGCCTCCGGTCGCCTTGGCTCCACCCTGGTTGAACGGTTGCTGCAAAGAGGCTACACTGTCCATGCTGCAGTTCAGGGCCACGGTGATTTGAAATTCAATGGGGTGGCAGCTGGTGAAAACAAGAAGCTGAAGGTTTTCCGTGCAGACCCTTTTGACTATCAGAGCATCATCGATGCTCTGAAAGGTTGCTCTGGTTTGTTTTACGCGTTTGAGCCTCCAGAAGACCACCTCGCCTATGATGAATTTATGGCAGAGGTGGAGGTAAGAGCAGCACACAATGTGATATAGGCATGCGCTCAGACGGATACGATAGACAAGGTGGTCTTCACGTCGTCTGCAACCGCTGTAGTTTGGAGAGACACCCCTCAATCTGTTGCTTCGGATTTGGATGAAAGGCACTGGAGCGATGAANATTTCTGTCGCAAATTCAAGTTGTGGGAAGCCCTATCAAAGACGCTGACAGAGAAGACAGCTTGGGCATTGGCAATGGACAGGGGCATCAACATGGTGTCCGTCAACGGGGGACTGTTGACG


Protein sequences

Name Description Sequence
Tcc.1119 translated coding region predicted by ESTScan from UniGene Tcc.1119

MAPASFHHEKVCVMDASGRLGSTLVERLLQRGYTVHAAVQGHGDLKFNGVAAGENKKLKVFRADPFDYQSIIDALKGCSGLFYAFEPPEDHLAYDEFMAEVEVRAAHNVIXACAQTDTIDKVVFTSSATAVVWRDTPQSVASDLDERHWSDEXFCRKFKLWEALSKTLTEKTAWALAMDRGINMVSVNGGLLT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
1-188 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MAPASFHHEKVCVMDASGRLGSTLVERLLQRGYTVHAAVQGHGDLKFNGVAAGENKKLKVFRADPFDYQSIIDALKGCSGLFYAFEPPEDHLAYDEFMAEVEVRAAHNVIXACAQTDTIDKVVFTSSATAVVWRDTPQSVASDLDERHWSDEXFCRKFKLWEALSKTLTEKTAWALAMDRGINMVSVN

HMMPanther: PTHR10366
1-188 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MAPASFHHEKVCVMDASGRLGSTLVERLLQRGYTVHAAVQGHGDLKFNGVAAGENKKLKVFRADPFDYQSIIDALKGCSGLFYAFEPPEDHLAYDEFMAEVEVRAAHNVIXACAQTDTIDKVVFTSSATAVVWRDTPQSVASDLDERHWSDEXFCRKFKLWEALSKTLTEKTAWALAMDRGINMVSVN

Gene3D: G3DSA:3.40.50.720
IPR016040
8-192 no description
NAD(P)-binding domain

HEKVCVMDASGRLGSTLVERLLQRGYTVHAAVQGHGDLKFNGVAAGENKKLKVFRADPFDYQSIIDALKGCSGLFYAFEPPEDHLAYDEFMAEVEVRAAHNVIXACAQTDTIDKVVFTSSATAVVWRDTPQSVASDLDERHWSDEXFCRKFKLWEALSKTLTEKTAWALAMDRGINMVSVNGGLL

superfamily: SSF51735
9-191 NAD(P)-binding Rossmann-fold domains

EKVCVMDASGRLGSTLVERLLQRGYTVHAAVQGHGDLKFNGVAAGENKKLKVFRADPFDYQSIIDALKGCSGLFYAFEPPEDHLAYDEFMAEVEVRAAHNVIXACAQTDTIDKVVFTSSATAVVWRDTPQSVASDLDERHWSDEXFCRKFKLWEALSKTLTEKTAWALAMDRGINMVSVNGGL

HMMPfam: PF13460
12-136 NAD_binding_10,NADH(P)-binding

CVMDASGRLGSTLVERLLQRGYTVHAAVQGHGDLKFNGVAAGENKKLKVFRADPFDYQSIIDALKGCSGLFYAFEPPEDHLAYDEFMAEVEVRAAHNVIXACAQTDTIDKVVFTSSATAVVWRDT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox