PRGDB00078136 (Tcc.1299)

From PRG Wiki
Jump to: navigation, search
Tcc.1299
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212314948 (CU619362)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Theobroma cacao

Comment?

CU619362 STEMS_KZ0AAA Theobroma cacao cDNA clone KZ0AAA14YI09FM1, mRNA sequence

DNA Sequence

ttttttttttttttttCCAAAAAGGCAACTGAAATGGAGATTGGCGTCATATATATCAAAAGCCTTTGAGAATTTAGCACAAGAAATGTAGGAATTTTGTAAGCAAGCACTGCCATTTTGCATACATCTCCCAATTTTACTCTAAAGCTACATTGATTCATTATCTTGCTTGCTGAATATCAAAGGGAAATCATCGAACTGTTCTGAGAAACCAAGTTCCTCAGCCATGCTTTTCAATGACTGGTAAACCTGGTACATGGACCATCTTTCCTTTGGCCGAGCAACCACACAATTACATGCAATTTTGAGGAACTGCAAAATTTCCTCATCATGCCCCTTTCCACGGAGAGAATTGTCGATGGCATCCTTGATTCTGCCAGAGCTAGAGAGATGATTTACCCAATCCACCAAATTACCCTTAAATCCTTCTTCACCTGCATTAATTTCTAAGGGTTTTTGCCTAGTTACCAATTCCAGAAAAACTACACCAAATCCATACACATCCCCTTTAAGTGTAGTGACCATAGTGCTTGAGTACTCTGGAGCTATATAACCAAATTCCCCTAAGTCTCCATTCTCAAAACTAGTCCCATTAACATCTGAGGAAGTCATGAGCCCTGCCAATCCAAAATCCATTATCCTAGCATCA


Protein sequences

Name Description Sequence
Tcc.1299 translated coding region predicted by ESTScan from UniGene Tcc.1299

XDARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQSLKSMAEELGFSEQFDDFPLIFSKQDNESM

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-142 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XDARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQSLKSM

HMMPanther: PTHR24420:SF477
2-165 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQSLKSMAEELGFSEQFDDFPLIFSKQDNE

HMMPanther: PTHR24420
2-165 FAMILY NOT NAMED,FAMILY NOT NAMED

DARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQSLKSMAEELGFSEQFDDFPLIFSKQDNE

Gene3D: G3DSA:1.10.510.10
3-139 no description

ARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQSL

superfamily: SSF56112
IPR011009
3-139 Protein kinase-like (PK-like)
Protein kinase-like domain

ARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQSL

HMMPfam: PF00069
IPR017442
3-138 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ARIMDFGLAGLMTSSDVNGTSFENGDLGEFGYIAPEYSSTMVTTLKGDVYGFGVVFLELVTRQKPLEINAGEEGFKGNLVDWVNHLSSSGRIKDAIDNSLRGKGHDEEILQFLKIACNCVVARPKERWSMYQVYQS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox