PRGDB00078137 (Tcc.1648)

From PRG Wiki
Jump to: navigation, search
Tcc.1648
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223633116 (ES441600)
Gene Class Unknown
Domain Type LRR
Gene Species Theobroma cacao

Comment?

[[Has Description::TSH_EST00098 Theobroma cacao-Moniliophthora perniciosa incompatible interaction library Theobroma cacao cDNA clone RT-Contig98 5' similar to leucine-rich repeat family protein [Arabidopsis thaliana] pir|B96534 hypothetical protein F14J22.4 [imported] ->]]

DNA Sequence

GCCAACAACAAGTTTACTGGTCCTATTCCGCCAAGCATTGGCAGAGCTCGTAACCTACTCGAAGTGCTTTTCCTCAACAACCAACTTACAGGGTGCTTGCCTTATGAGATTGGGTATCTGAGTAAAGCCACTGTGTTTGATGTAGGCTCCAACAAGTTAACAGGCCCTATACCAAACTCGTTTGGGTGCCTAAGAAAGATTGAGCTGCTCAATTTGGCCAACAACGAGTTCTACGGGGCAGTACCAGAAATAGTCTGCCAGCTCCCGAAGATCGAAAATTTGTCTTTGGCAAATAACTATTTCACTCAGGTTGGTCCTGCTTGTAGGAAATTGATATGGAAAAAGAAACTTGATGTAAGGAACAACTGCATTTTGGACCTGCCGAATCAAAAATCAAAAGATGAGTGCGCTAAATTTTTCTCAAGACCGCCGCTGGGTTGCGAGAGGAAGGAATCTTTTAAGTGGGTTCCTTGCATGAAAGGTGGTTATGATTATTCCAATTCAACGGAGAAATCTCACCAAGAATCAACTGCTTCCCTCCCAACTGTTAAAACTTATAGCACTCTTATTCCTCATCGGTTGTGATTTCCTTGCTGTTGATGGACCTCATTAAGAAAAATCATGATGGGGTCTTTGGCTATTTCTTTCTGTTGATACTTATCTCATATTGTATGCAGAACTTCAGTGTACTGTTGAATTTATTAGTGAATAAATGAACTTCCTTTTTCCT


Protein sequences

Name Description Sequence
Tcc.1648 translated coding region predicted by ESTScan from UniGene Tcc.1648

ANNKFTGPIPPSIGRARNLLEVLFLNNQLTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQKSKDECAKFFSRPPLGCERKESFKWVPCMKGGYDYSNSTEKSHQESTASLPTVKTYSTLIPHRL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF937
1-131 SUBFAMILY NOT NAMED

ANNKFTGPIPPSIGRARNLLEVLFLNNQLTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQK

HMMPanther: PTHR24420
1-131 FAMILY NOT NAMED,FAMILY NOT NAMED

ANNKFTGPIPPSIGRARNLLEVLFLNNQLTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQK

superfamily: SSF52058
1-148 L domain-like,LRR

ANNKFTGPIPPSIGRARNLLEVLFLNNQLTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQKSKDECAKFFSRPPLGCE

Gene3D: G3DSA:3.80.10.10
1-127 no description

ANNKFTGPIPPSIGRARNLLEVLFLNNQLTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox