PRGDB00078138 (Tcc.1922)

From PRG Wiki
Jump to: navigation, search
Tcc.1922
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38499407 (CF973647)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Theobroma cacao

Comment?

PSU_boln6F10 Defense-related ESTs from Cacao Leaves Theobroma cacao cDNA, mRNA sequence

DNA Sequence

GTTCTGCTTGTAACATAATGACATGGTGTATTAGCAGCATGGAACAAACAATTCTACCTTCCATCTCCAATAATATCAGCGAATTCAGTAACATTTGCTGGAGAGAGCACTGGTTCTGTCCCTGACATAGTCTTGCTCTTACCGCTCTTGATGTCACTGTTATCGGATGCAATGGATGTTTGTGTTTCTTCACTCATGAAGGTGCCTGTTATATCCTTAAAATGCCAATCAGTTAAATAACTTGGTTTTGACGTGACACTGCTCACTTCAATATCTCCAGCAAGCATAGCCACAACACGAGACGTGGGCGGCCGCATCGCTGGTGATGCCTGAGTGCATAAAAGTGCCACTCCTATCATTCGGAGAGCTTCATTTTCATCAAACTCCACTAAAGATGGATCCACCAGACCCAAGCTTTGGTTATTTTCATGCAGGGTCCATGCCCATTCAAGAAGATAAATCCTATCATTTTCTAGGCTATTGTCAGAGTTTGGNCTACCACTGACAATCTCCAAAGCAACAACACCAAAGNCAAAAACATCAGCCTTCTCAGTGAGATGNCCACGCATTGCATACTCCGGCGCCAGGTAACCAATGGGTCCAGCAACCCGAGTGCTGATGNGCGGTTTCTTGNCATCATAAAGCTTTGCCAATCCCAAAATCAGATATNTT


Protein sequences

Name Description Sequence
Tcc.1922 translated coding region predicted by ESTScan from UniGene Tcc.1922

XXYLILGLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIYLLEWAWTLHENNQSLGLVDPSLVEFDENEALRMIGVALLCTQASPAMRPPTSRVVAMLAGDIEVSSVTSKPSYLTDWHFKDITGTFMSEETQTSIASDNSDIKSGKSKTMSGTEPVLSPANVTEFADIIGDGRXNCLFHAANTPCHYVTSRT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-137 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XXYLILGLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIYLLEWAWTLHENNQSLGLVDPSLVEFDENEALRMIGVALLCTQASPAMRPPTSRVVAMLAGDIEV

Gene3D: G3DSA:1.10.510.10
7-130 no description

GLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIYLLEWAWTLHENNQSLGLVDPSLVEFDENEALRMIGVALLCTQASPAMRPPTSRVVAM

HMMPfam: PF07714
IPR001245
7-73 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

GLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIY

HMMPanther: PTHR24420:SF469
7-202 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIYLLEWAWTLHENNQSLGLVDPSLVEFDENEALRMIGVALLCTQASPAMRPPTSRVVAMLAGDIEVSSVTSKPSYLTDWHFKDITGTFMSEETQTSIASDNSDIKSGKSKTMSGTEPVLSPANVTEFADII

HMMPanther: PTHR24420
7-202 FAMILY NOT NAMED,FAMILY NOT NAMED

GLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIYLLEWAWTLHENNQSLGLVDPSLVEFDENEALRMIGVALLCTQASPAMRPPTSRVVAMLAGDIEVSSVTSKPSYLTDWHFKDITGTFMSEETQTSIASDNSDIKSGKSKTMSGTEPVLSPANVTEFADII

superfamily: SSF56112
IPR011009
7-177 Protein kinase-like (PK-like)
Protein kinase-like domain

GLAKLYDXKKPXISTRVAGPIGYLAPEYAMRGHLTEKADVFXFGVVALEIVSGXPNSDNSLENDRIYLLEWAWTLHENNQSLGLVDPSLVEFDENEALRMIGVALLCTQASPAMRPPTSRVVAMLAGDIEVSSVTSKPSYLTDWHFKDITGTFMSEETQTSIASDNSDIKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox