PRGDB00078140 (Tcc.2308)

From PRG Wiki
Jump to: navigation, search
Tcc.2308
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212134493 (CU628131)
Gene Class Unknown
Domain Type
Gene Species Theobroma cacao

Comment?

CU628131 COTYLEI_KZ0ABB Theobroma cacao cDNA clone KZ0ABB10YJ04FM1, mRNA sequence

DNA Sequence

ttttttttttttttttGACCCAAAAATAAACATATATGAAATAGAGCATAAAACAGTAAGTAACATATCAAGTACGGGATTCGGAACGCCTGAGGAGAAGCAAAGTAGGGAAACATTTTTTACAGAGTACCCTGAAGCAGATGGTAAAGAAAAGTAATTACATGGATAGCAGGTTCATCAAATTCTGGAAGGGATCATAGGAATGGTGTTCTGCAAGTATGCACAGGCAGCGGCAACTCCACTTCCAAGCTTAACTGGATATCCCACATCTTTGAGTATCATCTCCACACCAGCTAGACAACCCAACAGTTGCAACTCATTTAGGTTTCCAAGATGTCCTATTCTGAACACTTTACCAGCCACTTTGTTAAGGCCCAGACCTAAGCTTAAATTGTATCTCTTCCATGCCCTTCTAACAATTTCTGTACTATCAATATATGGGGGAACAAGGACAGCAGTCACAGTGTCACTGTACCATTCCTCCTTTTGTGTGCAGTTCTTCAAGCCCCAAGCCTCCACGGCAAGCCTTGTTGCTTTTCCCAAACGGCTATGCCTTGCAATCACATTGTCAAGTCCTTCCTCAAAAATAAGATCCAGAGCTGCTCTAAGCCCATACAACAGTTGGACTGAAGGGGTGTATGGCCAAAACGTTCCCCGTTTGTAAAACTTGAG


Protein sequences

Name Description Sequence
Tcc.2308 translated coding region predicted by ESTScan from UniGene Tcc.2308

LKFYKRGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-164 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LKFYKRGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI

HMMPanther: PTHR21152
1-164 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

LKFYKRGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI

superfamily: SSF53383
IPR015424
9-140 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

FWPYTPSVQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPV

Gene3D: G3DSA:3.90.1150.10
IPR015422
10-146 no description
Pyridoxal phosphate-dependent transferase, major r

WPYTPSVQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox