PRGDB00078143 (Tcc.2860)

From PRG Wiki
Jump to: navigation, search
Tcc.2860
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223632481 (ES440281)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Theobroma cacao

Comment?

BAB03621.1| putative protein kinase Xa21 [Ory>

DNA Sequence

GATTGTCTAAGCTCCTGTCTAGCGACACAGACACTATGGGCAATGATCAAACAGGTTCCTCAATGATGAAAGGAACAATTGGTTATGTTCCCCCAGAATATGGCACGGGCGGGACAGTGTCCCCAGAAGGTGATATCTACAGCTATGGGATTCTGCTCTTAGAGATGATCACCAGAAGGAGACCAACGGATGGTATGTTTCATGGCGGCTTAAGCCTTCACAATTTCTGTAACATGGCACTGCCTGATCGGTTGAAGGAGATTCTCGATTTTCACTTGCTCGCACAACTTAGTGAAAACAACGAGAGATTAAGAAGTCAACCGAACAGGGAAAGAGAGATGTTGGAGAGTTTGGTTTCTTTCACTAAAATAGGAGTTGCATGCTCTGCAGAAGCACCTGGTGAAAGAATGGGAATCCAAGATGCTATTACACAACTACTTGCTATTA


Protein sequences

Name Description Sequence
Tcc.2860 translated coding region predicted by ESTScan from UniGene Tcc.2860

XLSKLLSSDTDTMGNDQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGMFHGGLSLHNFCNMALPDRLKEILDFHLLAQLSENNERLRSQPNREREMLESLVSFTKIGVACSAEAPGERMGIQDAITQLLAIX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-150 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLSKLLSSDTDTMGNDQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGMFHGGLSLHNFCNMALPDRLKEILDFHLLAQLSENNERLRSQPNREREMLESLVSFTKIGVACSAEAPGERMGIQDAITQLLAIX

superfamily: SSF56112
IPR011009
2-146 Protein kinase-like (PK-like)
Protein kinase-like domain

LSKLLSSDTDTMGNDQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGMFHGGLSLHNFCNMALPDRLKEILDFHLLAQLSENNERLRSQPNREREMLESLVSFTKIGVACSAEAPGERMGIQDAITQL

HMMPanther: PTHR24420:SF474
2-149 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LSKLLSSDTDTMGNDQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGMFHGGLSLHNFCNMALPDRLKEILDFHLLAQLSENNERLRSQPNREREMLESLVSFTKIGVACSAEAPGERMGIQDAITQLLAI

HMMPanther: PTHR24420
2-149 FAMILY NOT NAMED,FAMILY NOT NAMED

LSKLLSSDTDTMGNDQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGMFHGGLSLHNFCNMALPDRLKEILDFHLLAQLSENNERLRSQPNREREMLESLVSFTKIGVACSAEAPGERMGIQDAITQLLAI

Gene3D: G3DSA:1.10.510.10
16-146 no description

DQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGMFHGGLSLHNFCNMALPDRLKEILDFHLLAQLSENNERLRSQPNREREMLESLVSFTKIGVACSAEAPGERMGIQDAITQL

HMMPfam: PF00069
IPR017442
16-66 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DQTGSSMMKGTIGYVPPEYGTGGTVSPEGDIYSYGILLLEMITRRRPTDGM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox