PRGDB00078145 (Tcc.2968)

From PRG Wiki
Jump to: navigation, search
Tcc.2968
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 215532153 (CU586020)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Theobroma cacao

Comment?

CU586020 OVULEI_KZ0AAB Theobroma cacao cDNA clone KZ0AAB8YF18FM1, mRNA sequence

DNA Sequence

CGGGGAATGCAGATGACATCATAATGCTTTGCCATATTGTCCAATAATTTTTTCTGGCTTGAAGTTAAATTTCAGTTCTTTACTTGCTTGACAGGGGAGAACCAGACTATCGAGTGGGCCATGCGGTTGAGAGTTGCTTTATATATAGCTGAAGCATTAGATTATTGTAGTAGTGAAGGTCGTCTGTTGTATCATGATTTGAATGCATATAGGGTTCTCTTTGATGAGAATGGTGATCCTCGACTTTCATGTTTTGGCTTGATGAAGAACAGTAGGGATGGGAAAAGTTATAGTACCAATCTTGCATATACACCTCCTGAGTATCTAAGAAATGGAAGGGTTACTCCTGAAAGTGTTATATTCAGCTTCGGAACTGTCCTTTTGGATCTTCTCAGTGGAAAGCATATTCCTCCAAGTCACGCTCTTGATATGATACGGGGCAAAAACATTCTTCTCTTAATGGATTCGCATCTAGAGGGAAACTTTTCAACTGAAGAGGCAACAGTGGTCTTTGATCTGGCTTCACGATGTTTGCAATATGAACCAAGGGAGCGGCCAAACACCAAAGATCTTGTTACTACACTTGCCCCATTGCAAAATAAACCTGATGTTCCGTCTTATGTGATGTTGGGAATTCCCAAGCATGAGGAGGGGCCTCCTACTCCTCAGCACCCTCTATCTCCCATGGGAGATGCCTGCTCACGGATGGATCTCACTGCTATTCATCAAATTTTGGTAATGACACATTACAAAGATGATGAAGGAACAAATG


Protein sequences

Name Description Sequence
Tcc.2968 translated coding region predicted by ESTScan from UniGene Tcc.2968

RGMQMTSXCFAILSNNFFWLEVKFQFFTCLTGENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQNKPDVPSYVMLGIPKHEEGPPTPQHPLSPMGDACSRMDLTAIHQILVMTHYKDDEGTNX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-199 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RGMQMTSXCFAILSNNFFWLEVKFQFFTCLTGENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQ

HMMPfam: PF00069
IPR017442
26-193 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FFTCLTGENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVT

superfamily: SSF56112
IPR011009
27-218 Protein kinase-like (PK-like)
Protein kinase-like domain

FTCLTGENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQNKPDVPSYVMLGIPKHEEG

Gene3D: G3DSA:1.10.510.10
33-200 no description

ENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQN

HMMPanther: PTHR24420:SF885
33-255 SUBFAMILY NOT NAMED

ENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQNKPDVPSYVMLGIPKHEEGPPTPQHPLSPMGDACSRMDLTAIHQILVMTHYKDDEG

HMMPanther: PTHR24420
33-255 FAMILY NOT NAMED,FAMILY NOT NAMED

ENQTIEWAMRLRVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQNKPDVPSYVMLGIPKHEEGPPTPQHPLSPMGDACSRMDLTAIHQILVMTHYKDDEG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox