PRGDB00078146 (Tcc.3270)

From PRG Wiki
Jump to: navigation, search
Tcc.3270
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212312366 (CU619496)
Gene Class Unknown
Domain Type
Gene Species Theobroma cacao

Comment?

CU619496 STEMS_KZ0AAA Theobroma cacao cDNA clone KZ0AAA15YB07FM1, mRNA sequence

DNA Sequence

CGGGGACAGTCACCAGGAAACAAGAGAGAGATGAGTGAAGCAGGCAAGGTGGTGTGTGTAACGGGAGCATCAGGTTACATAGCCTCATGGCTGGTTAAGTTTTTACTCCAACGTGGTTACACCGTCAAAGCCACTGTTCGTGACCCAAGTGATCCAAAGAAAACAGAGCACTTACTTGCGCTTGATGGAGCAAAGGAAAGGCTTCATTTGTTCAAGGCAGAGCTTCTGGATGAGGGAGCTTTTGATTCAGTAGTTGATGGATGTGTAGGAGTTTTCCACACAGCATCTCCTTTTTATCACAATATCAAGGATCCTCAGGCTGAAATGATTGACCCAGCTGTAAAGGGAACACTTAATGTTCTTAGGTCATGTGCTAAAGTTCCATCTATTAAACGGGTGGTTATAACATCCTCAGTTGCAGCTGTTGTGTATAATGGAAGGCCTCTGGGCCCTGATGTTAAAGTTGATGAGACTTGGTTCTCTGATCCCACTTTTTGTGAGAAATCAAAGCTTTGGTATATGCTTTCTAAGACGTTAGCTGAGGAGGCTGCTTGGAAGTATGCAAAAGATAATGGAATTGACATGGTTACAGTAAACCCAGGATTGGTGATTGGACCTCTTTTACAGCCGACCATTAATGCAAGTGTGGAGCCAATATTGAAGCTTATAAATGGGGCTGAAACATTTCCAAATACAAATTACAGATTGATAGACGTTAGAGATGTTGCAAACGCACATATACTAGCATATGAGAATTCTTCAGCTTGTGGA


Protein sequences

Name Description Sequence
Tcc.3270 translated coding region predicted by ESTScan from UniGene Tcc.3270

RGQSPGNKREMSEAGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHLFKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPNTNYRLIDVRDVANAHILAYENSSACG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
1-257 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

RGQSPGNKREMSEAGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHLFKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPNTNYRLIDVRDVANAHILAYENSSACG

HMMPanther: PTHR10366
1-257 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

RGQSPGNKREMSEAGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHLFKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPNTNYRLIDVRDVANAHILAYENSSACG

superfamily: SSF51735
11-255 NAD(P)-binding Rossmann-fold domains

MSEAGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHLFKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPNTNYRLIDVRDVANAHILAYENSSA

Gene3D: G3DSA:3.40.50.720
IPR016040
16-231 no description
NAD(P)-binding domain

KVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHLFKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPN

HMMPfam: PF01370
IPR001509
18-253 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHLFKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPNTNYRLIDVRDVANAHILAYENS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox