PRGDB00078149 (Tcc.4170)

From PRG Wiki
Jump to: navigation, search
Tcc.4170
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212100257 (CU592082)
Gene Class Unknown
Domain Type
Gene Species Theobroma cacao

Comment?

CU592082 SEED34I_KZ0AAH Theobroma cacao cDNA clone KZ0AAH13YG19FM1, mRNA sequence

DNA Sequence

CGGGTGGCAAATACCCTGTTTTTGATGTAGGAACCTATAACAAGATCAAGTCCGGGGAGATTCAGGTGTTGCCAGCTATATCGAGTATACGAGGCAGTGAGGTGGTGTTCGGACACGGTGTAACTCATCCCTTCGACACAATTATTTTCTGCACTGGCTTCAAGAGGTCCACAAATGTCTGGCTCAAGGGAGATGAATACCTGCTGAACGATGATGGACTTCCCAAACCGAGTTTCCCAAACCATTGGAAGGGAAAGAATGGTTTGTACTGCGTTGGATTGTCAAGAAGAGGATTGTATGGTGCGAGTGCTGATGCTCAGAACATAGCCAATGATATCAAGTCACTTCTGTAAGGAGTCCCTTCAACAGAAGGAATTATTATGATGCAATCAATGGTTTATGCGTAATGTTTGGTACCTTCTTTAATGAGTCCCTACTCTCCTACTTGAAACAGTCTTGCTCATAAAAAGACATGTCATGGTATTGGGGGAAAAAGAAATTGTTTATTAAGACAGTTTTTATGAGCTATATTACATGCTGAAAGTTCCTaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Tcc.4170 translated coding region predicted by ESTScan from UniGene Tcc.4170

XGGKYPVFDVGTYNKIKSGEIQVLPAISSIRGSEVVFGHGVTHPFDTIIFCTGFKRSTNVWLKGDEYLLNDDGLPKPSFPNHWKGKNGLYCVGLSRRGLYGASADAQNIANDIKSLL

Domains

Domain Start-End Description Sequence

superfamily: SSF51905
2-54 FAD/NAD(P)-binding domain

GGKYPVFDVGTYNKIKSGEIQVLPAISSIRGSEVVFGHGVTHPFDTIIFCTGF

HMMPanther: PTHR23023:SF5
3-115 MONOOXYGENASE,MONOOXYGENASE

GKYPVFDVGTYNKIKSGEIQVLPAISSIRGSEVVFGHGVTHPFDTIIFCTGFKRSTNVWLKGDEYLLNDDGLPKPSFPNHWKGKNGLYCVGLSRRGLYGASADAQNIANDIKS

HMMPanther: PTHR23023
3-115 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

GKYPVFDVGTYNKIKSGEIQVLPAISSIRGSEVVFGHGVTHPFDTIIFCTGFKRSTNVWLKGDEYLLNDDGLPKPSFPNHWKGKNGLYCVGLSRRGLYGASADAQNIANDIKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox