PRGDB00078150 (Tcc.4538)

From PRG Wiki
Jump to: navigation, search
Tcc.4538
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211972491 (CU472276)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Theobroma cacao

Comment?

CU472276 CHERELS_KZ0AAC Theobroma cacao cDNA clone KZ0AAC1YA13, mRNA sequence

DNA Sequence

CGGGGTGGACTTTGATGTCGTTTCATAAGTTGGGTTTTAGTGAATATGAGATTTTGGACTGTCTTGACGAGGATAATGTGATAGGGAGAGGATCTTCAGGGAAGGTTTACAAGGTCGTGCTTAGTAATGGGGAGGCTGTTGCCGTGAAGAAGCTTTGGGGAGGAGCGAAAAAGGGTTGTGAGAGTGTAGATCTTGAGAAAGGTCAGGCTCAGGTTCAGGATGATGGGTTTGAAGCTGAGGTTGAGACTTTGGGGAAGATTAGGCACAAGAATATTGTTAAGTTGTGGTGTTGTTGTACTACCAGGGATTGCAAGCTTTTGGTGTATGAGTACATGCAGAATGGTAGCTTGGGTGATTTATTGCATAGTAGTAAAGGTGGTTTGCTGGATTGGCCGACAAGGTACAAGATTATTGTGGATGCAGCTGAGGGGCTTTCTTATTTGCATCATGATTGTGTGCCTGCGATTGTGCATAGAGATGTTAAGTCCAATAATATCTTGTTGGATGGGGATTTTGGTGCTCGAGTGGCAGATTTCGGTGTTGCCAAGGTGGTTGATGCAGCTGGAAGGGGTGCTAAATCCATGTCTGTTATTGCAGGGTCCTGCGGTTACATTGCTCCAGAGTATGCATATACACTTCGAGTGAATGAGAAGAGTGACATATACAGTTTTGGGGTTGTTATACTTGAGTTGGTCACAGGCAGACTCCCAATTGACCCGGAGTATGGGGAGAAGGACCTGGTAAAGTGGGTTTGCACCACTCTGGATCAGAAAGGAGTGGACCATGTTCTTGATTCCAAACTCGATCCTTGTTTCAAAGAAGAAATATGCAAGGTCCTCAACATCGGCCTCCTCTGTACCAGTCCGCTCCCAATCAACCGCCCGTCAATGAGAAGGGTGGTTAAGATGTTGCAAGAAGCAGGTGCTGAGAGCCATCCGAAGGCTGCTGCTAAAAAGGATGGGAAATTGACTCCTTATTACTATGAAGATGCCTCAGATCAAGGAAGTGTAGCTTGAGAAAAATTTATCCTTGTATAGCTTGTTGCAAAAACAAAGGCACAAGGGTGATACGCCCCTAtttttttttGCTCTCGAGTTTTGCTTGTCAATCATTGTACCCACTTGATGTTTGCTTTACAGGTTGGTTTAAGTGGGGAGGAAAGTGAGTAGGAGTTGAAATTTACACAGTGAAagagagagagagagagagGGAAAAAGAAAGGAAGAGAGGCAGATTTATTAAGGAGTTAATGCACACTGTAAATTTATTAACAATGAAGGTTTTATTCCACGTCGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Tcc.4538 translated coding region predicted by ESTScan from UniGene Tcc.4538

XGWTLMSFHKLGFSEYEILDCLDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKMLQEAGAESHPKAAAKKDGKLTPYYYEDASDQGSVA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF884
3-334 SUBFAMILY NOT NAMED

WTLMSFHKLGFSEYEILDCLDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKMLQEAGAESHPKAAAKKDGKLTPYYYEDASDQ

HMMPanther: PTHR24420
3-334 FAMILY NOT NAMED,FAMILY NOT NAMED

WTLMSFHKLGFSEYEILDCLDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKMLQEAGAESHPKAAAKKDGKLTPYYYEDASDQ

superfamily: SSF56112
IPR011009
18-304 Protein kinase-like (PK-like)
Protein kinase-like domain

ILDCLDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKML

Gene3D: G3DSA:3.30.200.20
21-98 no description

CLDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCC

ProfileScan: PS50011
IPR000719
22-315 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKMLQEAGAESHPKA

HMMSmart: SM00219
IPR020635
22-304 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKML

HMMSmart: SM00220
IPR002290
22-304 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LDEDNVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKML

HMMPfam: PF00069
IPR017442
26-258 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NVIGRGSSGKVYKVVLSNGEAVAVKKLWGGAKKGCESVDLEKGQAQVQDDGFEAEVETLGKIRHKNIVKLWCCCTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQK

PatternScan: PS00107
IPR017441
28-51 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGSSGKVYKVVLSNGEAVAVKK

Gene3D: G3DSA:1.10.510.10
99-303 no description

CTTRDCKLLVYEYMQNGSLGDLLHSSKGGLLDWPTRYKIIVDAAEGLSYLHHDCVPAIVHRDVKSNNILLDGDFGARVADFGVAKVVDAAGRGAKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPIDPEYGEKDLVKWVCTTLDQKGVDHVLDSKLDPCFKEEICKVLNIGLLCTSPLPINRPSMRRVVKM

PatternScan: PS00108
IPR008271
156-168 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKSNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox