PRGDB00078248 (Tcc.25185)

From PRG Wiki
Jump to: navigation, search
Tcc.25185
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212342054 (CU614935)
Gene Class Unknown
Domain Type
Gene Species Theobroma cacao

Comment?

CU614935 TPFERMI_A_KZ0AAN Theobroma cacao cDNA clone KZ0AAN1YB23, mRNA sequence

DNA Sequence

ttttttttttttttATCTGGTACTTTCAATGTTTTATTTGTTTTTGTTGAATTTGTCTTTGATTACGTCCTTGTCAATGTTATTTGGAACAGGAGGGGAAAGAGGGTGCGCGGCGTTTTTGGGGAGGGGACCTATTGGCCGAAAAACTTGGACTCTTGGTGGAGGGGGTTGTGAAAGCAATTAATTTTGAGTGGTAGTGTCCATCTAAAGAGCTGGAAAttttttttGCCTGGCTCCCACTGGTGGGGTCCGGGGAAACTCAAACTACACGTGGCTTAAGCCTGTCCAGGTGGATCTGCTTTTTGGGGCTcccccccccccGGAATAGGGGGGTGCTTTAAACTTTGTTGGAAGCGTCCGGATCCGGAGGGTTTCCCTTAATTTTTTGGGCTTGAACAACTCCCCCATTGGTGTTTGTCTCGTTTGGCTGAGGAGCCCCAGCGTTCCCTTCTGAGCACCCCATGGTGCCTAGTTTGACAACATCAACGATGTGCTCTGATAGTTGGTGAAGCTTTGGATCTTCCACCATTTTCTTGGGGCAGTTCTTGTAGATTGCATAAAGTATCATTTGAAGAATTCCAAAGATAAAGCCAACAACATTTGGAACAGCAATGTTCATATCCTTCAACAGAAGGCCATAGAAGAACCACATCACTGCTCCTAAGGTGAGGAACACTGATAAAGTAAATGGCATGTATTCAACGCTCTTGGTTTTTATGACTTTTCTCAAAATGCAAAGAAGTGCAGCGAACACACTCAAAGCGAATGCCATGCATATATATCCAAGAACATGGAGACGTGTCAAGGGGTTTTGTAGGAAGAAAGTTGAGAGAAAGATAACTCCGAACCCGAAAATATTGAACAGGAGGATAAGCTTCACAGTCACGACCTTTTCCTTCTTGGGAGCATAGTAAAAGTAAGCAACAATGTAAAAGGTCTGAATGAAGCAGCAGAAAGTGTTGATGGTTATGAGAAACATAGCATCCTTCTTAAGGAGTGCGTAGTAAATCCAAAGCATCGCACTGAAGAGAGACACCACGTAAGGAATTGATTGGAACCCTTCGGATGTTCTCTTCTTGTATATTTGGTAAAAGGTTGGCAAGGGAGCAAGGGAAACCAAAAATGAAACGACGTTGCCTAGAACGCCAAAAACGAAAGCCCAAGACAGGTGAAGAGCCATCTCTATTGCTATTAGATGTTTATGTAGTCGTTTCCTCTCTTTCTCTCTCAAAAGAAGTGTGTGTTGTCAAGTGAGGCTCTTGCTATCTCATTACTCTCACCCCAACCCCCG


Protein sequences

Name Description Sequence
Tcc.25185 translated coding region predicted by ESTScan from UniGene Tcc.25185

MALHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYALLKKDAMFLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFFLQNPLTRLHVLGYICMAFALSVFAALLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLSEHIVDVVKLGTMGCSEGNAGAPQPNETNTNGGVVQAQKIKGNPPDPDASNKV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
7-226 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

WAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYALLKKDAMFLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFFLQNPLTRLHVLGYICMAFALSVFAALLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQ

HMMPfam: PF03083
IPR004316
9-95 MtN3_slv
RAG1-activating protein-1-related

FVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYALLKKDAMFLITINTFCCFIQTFYIVAYFYYAPKK

HMMPfam: PF03083
IPR004316
131-214 MtN3_slv
RAG1-activating protein-1-related

VLGYICMAFALSVFAALLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox