PRGDB00078252 (Tcc.29184)

From PRG Wiki
Jump to: navigation, search
Tcc.29184
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212644362 (CU528729)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Theobroma cacao

Comment?

CU528729 WOODS_KZ0ACAA Theobroma cacao cDNA clone KZ0ACAA7YJ01FM1, mRNA sequence

DNA Sequence

CGGGGTCGCACCAGAATGGTTTAGGAACCTGCCAATAACTGTGAAGATTGATGTATATAGCTTTGGAGTGGTGCTACTAGAACTCACATGTTGCCGAAGAAGTGTAGATAGGAATTGCGATCTAGAAGAAAGAGCAATTTTAACAGACTGGGCTTATGACTGCTACCGTGAAGGCATATTGGATGCACTGGTTGAAAATGACACTGATGCCTTGAATGACAGAGGAAAAGTGGAGAGGTTTGTGCAAGTTGCCATCTGGTGTATTCAAGAAGACCCGTCCCTGAGACCTACCATGAGAAAAGCCACACAGATGCTTGAAGGAGTTGTGGAAGTGCCCATTCCACCATGTCCATATACTACGACTGCTTGAAATTCAGCTTTTAAAGTGATCAGCAGCAACCTTTGCTTCCATGTATAGACTGTACTGAAGTTTGTTTAACAAACTTTTTCTTGGAATAAGTTGTTGATTTAGGTGTTTGCTTCCACGTAAGGAAGCTCTATGTATTGAAGTACCTCAATTCCAGAGTAATATTATTTTGTACAAATAACTTAGTaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Tcc.29184 translated coding region predicted by ESTScan from UniGene Tcc.29184

XGVAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRNCDLEERAILTDWAYDCYREGILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQMLEGVVEVPIPPCPYTTTA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF815
3-118 RLK1 (RECEPTOR-LIKE PROTEIN KINASE 1); CARBOHYDRATE BINDING / KINASE

VAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRNCDLEERAILTDWAYDCYREGILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQMLEGVVEVPIPPCP

HMMPanther: PTHR24420
3-118 FAMILY NOT NAMED,FAMILY NOT NAMED

VAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRNCDLEERAILTDWAYDCYREGILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQMLEGVVEVPIPPCP

superfamily: SSF56112
IPR011009
3-120 Protein kinase-like (PK-like)
Protein kinase-like domain

VAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRNCDLEERAILTDWAYDCYREGILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQMLEGVVEVPIPPCPYT

Gene3D: G3DSA:1.10.510.10
3-106 no description

VAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRNCDLEERAILTDWAYDCYREGILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQML

HMMPfam: PF00069
IPR017442
3-104 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRNCDLEERAILTDWAYDCYREGILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox