PRGDB00078268 (Vun.403)

From PRG Wiki
Jump to: navigation, search
Vun.403
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 182650849 (FF546200)
Gene Class Unknown
Domain Type
Gene Species Vigna unguiculata

Comment?

MOPDN43TF MOP Vigna unguiculata cDNA 5', mRNA sequence

DNA Sequence

ACAACTTGGCCAAAGTGAGACAAATTCTCGATTCCTACAGGCATCCAGCACTGTTAATTGTTGATGGAGTGTCTTCAATTTGTGCTCTTGATTTTCGCATGGATGAATGGGGAGTAGATGTGGCCATAACTGGCTCTCAGAAGGCCCTTTCCCTTCCCACTGGGATAGGTATTGTGGTTGCAGGACCTAGAGCTATTGAAGCCTCAAAAACCGCTAAATCACTCAGAGTTTTCTTTGACTGGAAAGACTACCTGAAATTCTACCAGTTAGGAACCTATTGGCCATACACTCCTTCCATACATCTGCTGTATGGTCTCAGAGCTGCTCTTGATCTGGTTTTTGAAGAAGGGCTTGAAAATGTGATTGCAAGGCACGACCGTTTAGGCACAGCAACCAGACTTGCTGTAGAGGCATGGGGTTTGAAGAATTGCACCCAAAAGGAAGAGTGGCACAGTGACACAGTGACTGCTGTTGTTGTCCCTTCTTACATTGATAGTGCTGAAATAGTTAGAAGGGCATGGAAGAGATACAATTTGAGCTTAGGTCTTGGACTCAACAAAGTTGCTGGCAAGGTTTTCAGAATTGGACATCTTGGCTACTTGAATGAGTTGCAACTGTTGGGATGTCTAGCTGGTGTGGAGATGATACTGCAAGATGTGGGTTACCCTGTAAAGCTTGGAAGTGGAGTTGCTGCTGCCAGTGCATACTTTAAGAACACTATTCCTCTCATTCCTTCAAGGATTTGAGTCACAACCTATTTATTCTCTTCACTTCCTTTTCTGCTCTTTCAAAAATTCTGTAAAATATATATATTATCCTCTTTTACA


Protein sequences

Name Description Sequence
Vun.403 translated coding region predicted by ESTScan from UniGene Vun.403

XNLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHDRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
2-224 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

NLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHDRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPV

HMMPanther: PTHR21152:SF7
3-248 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHDRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI

HMMPanther: PTHR21152
3-248 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

LAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHDRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI

Gene3D: G3DSA:3.40.640.10
IPR015421
3-104 no description
Pyridoxal phosphate-dependent transferase, major r

LAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLY

HMMPfam: PF00266
IPR000192
14-172 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

RHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHDRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPSYIDSAEIVRR

PatternScan: PS00595
IPR020578
39-59 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVAITGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
105-230 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLVFEEGLENVIARHDRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox