PRGDB00078278 (Vun.1307)

From PRG Wiki
Jump to: navigation, search
Vun.1307
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 162292388 (FC458597)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Vigna unguiculata

Comment?

UCRVU07_CCNP432_b1 Cowpea UCR 779 Mixed Tissue and Conditions cDNA Library UCRVU07-1 Vigna unguiculata cDNA clone CCNP432, mRNA sequence

DNA Sequence

GTTGGATGAGAGGCGTATGCTTAGTATGGCTTATGATGGGGCAAAGGGGATGAATTATCTTCATAAACGAAACCCCCCCATTGTTCATAGAGATCTGAAATCTCCAAACCTTCTCGTTGACAAGAAATATACAGTGAAGGTTTGTGATTTTGGGCTTTCCCGTCTGAAGGCCAATACATTTCTCTCATCCAAGTCAGCTGCTGGGACTCCTGAGTGGATGGCTCCAGAGGTTCTTCGTGATGAGCCATCAAATGAAAAGTCAGATATTTACAGCTTTGGTGTAATCTTATGGGAGCTTGCAACATTGCAACAGCCATGGGTTAATTTAAATCCTGCACAGGTTGTGGCAGCTGTTGGCTTTAAGGGAAAAAGGCTTGAGATCCCACGTGATGTGAATCCCCAAGTAGCTGCCCTAATCGAGGCTTGCTGGGCCAACGAGCCTTGGAAACGACCTTCTTTTGCGAGTATTATGGATTCTTTGAGGCCATTGCTGAAACCCCCTACACCTCAACCTGGTCGTCCGAACATGTCATTACTCAGCTGAATGGTTGGAACACCAAGTAGCTGTTCATGCACATATGACAGGATTTTATCGATCTTGATGTCTAACAAGATTACACTATTTTTAGTTGTCCTAGAGTCAATTGTATATTTCTTTAATTCAGGTTTAAGATACTGATTTCCGACCCAGAGCAAGGATACTCCATCTTTATTGTTCCGACATATTGTTTGATTAGGTGATCTTGTAATTTTACTG


Protein sequences

Name Description Sequence
Vun.1307 translated coding region predicted by ESTScan from UniGene Vun.1307

XLDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLLKPPTPQPGRPNMSLLS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-165 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLL

HMMPanther: PTHR23257:SF80
2-166 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

LDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLLK

HMMPanther: PTHR23257
2-166 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLLK

Gene3D: G3DSA:1.10.510.10
2-166 no description

LDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLLK

superfamily: SSF56112
IPR011009
2-180 Protein kinase-like (PK-like)
Protein kinase-like domain

LDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLLKPPTPQPGRPNMSLL

HMMSmart: SM00220
IPR002290
2-165 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSLRPLL

HMMSmart: SM00219
IPR020635
2-161 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LDERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSL

HMMPfam: PF07714
IPR001245
3-161 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DERRMLSMAYDGAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWVNLNPAQVVAAVGFKGKRLEIPRDVNPQVAALIEACWANEPWKRPSFASIMDSL

FPrintScan: PR00109
IPR001245
22-40 TYRKINASE
Serine-threonine/tyrosine-protein kinase

HKRNPPIVHRDLKSPNLLV

PatternScan: PS00108
IPR008271
28-40 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSPNLLV

FPrintScan: PR00109
IPR001245
69-79 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTPEWMAPEVL

FPrintScan: PR00109
IPR001245
88-110 TYRKINASE
Serine-threonine/tyrosine-protein kinase

SDIYSFGVILWELATLQQPWVNL

FPrintScan: PR00109
IPR001245
132-154 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VNPQVAALIEACWANEPWKRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox