PRGDB00078280 (Vun.1551)

From PRG Wiki
Jump to: navigation, search
Vun.1551
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 162294940 (FC461398)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Vigna unguiculata

Comment?

UCRVU11_CCNW624_b1 Cowpea UCR 41 Mixed Tissue and Conditions cDNA Library UCRVU11-1 Vigna unguiculata cDNA clone CCNW624, mRNA sequence

DNA Sequence

GTTTTGGCGATAGGATCAACGAACGCCATGGCAGAGCTCACTCCGAAGAAGGAAAACCCGAACCTTCTGCTGGGCCGGTTCGAGCTGGGAAAACTCCTGGGGCACGGAACCTTCGCGAAGGTTCACCACGCCAGGAACATCAAAACCGGGGAAGGAGTGGCCATCAAGATCATAAACAAGGAAAAGATCCTGAAGGGCGGTTTGGTGTCCCACATCAAGCGCGAGATCTCCATCCTCCGGCGCGTCCGCCACCCCAACATCGTCCAACTCTTCGAAGTCATGGCCACCAAAACCAAGATCTACTTCGTCATGGAGTTCGTGCGCGGCGGGGAGCTCTTCAACAAGGTCGCCAAGGGAAGGTTGAAGGAAGAAGTTGCCAGAAAGTACTTCCAGCAGCTGGTTTCCGCGGTGGAGTTTTGCCATGCGCGCGGGGTGTTCCACAGGGACATCAAGCCCGAGAATTTGCTGCTGGATGAGGATGGGAACCTTAAAGTCTCCGACTTCGGACTCAGTGCTGTGTCGGATCAGATTAGGCAGGACGGGCTATTCCACACGTTTTGTGGGACACCCGCGTATGTTGCTCCTGAGGTTTTGGCGCGGAAAGGGTACGATGGTGCCAAGGTTGATATTTGGTCTTGTGGGGTTGTTTTGTTTGTTTTGATGGCGGGGTATTTGCCTTTCCATGACCGTAATGTTATGGCCATGTATAAGAAGATTTACAGGGGCGAGTTTCGGTGTCCCAGTGGTTCTCTCTGAACTTACTAGACTTCTCTGTGGGCTTCTTGATACCAACCCTCAGACCAGGATTTTC


Protein sequences

Name Description Sequence
Vun.1551 translated coding region predicted by ESTScan from UniGene Vun.1551

VLAIGSTNAMAELTPKKENPNLLLGRFELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPSGSL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343:SF45
10-248 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

MAELTPKKENPNLLLGRFELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPS

HMMPanther: PTHR24343
10-248 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MAELTPKKENPNLLLGRFELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPS

superfamily: SSF56112
IPR011009
13-248 Protein kinase-like (PK-like)
Protein kinase-like domain

LTPKKENPNLLLGRFELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPS

Gene3D: G3DSA:3.30.200.20
15-123 no description

PKKENPNLLLGRFELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKE

Seg: seg
22-34 seg

LLLGRFELGKLLG

HMMPfam: PF00069
IPR017442
27-241 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYR

ProfileScan: PS50011
IPR000719
27-251 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPSGSL

HMMSmart: SM00220
IPR002290
27-251 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPSGSL

HMMSmart: SM00219
IPR020635
27-251 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FELGKLLGHGTFAKVHHARNIKTGEGVAIKIINKEKILKGGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEFVRGGELFNKVAKGRLKEEVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPSGSL

PatternScan: PS00107
IPR017441
33-56 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGTFAKVHHARNIKTGEGVAIK

Gene3D: G3DSA:1.10.510.10
124-248 no description

EVARKYFQQLVSAVEFCHARGVFHRDIKPENLLLDEDGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVVLFVLMAGYLPFHDRNVMAMYKKIYRGEFRCPS

PatternScan: PS00108
IPR008271
145-157 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VFHRDIKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox