PRGDB00078293 (Vun.3451)

From PRG Wiki
Jump to: navigation, search
Vun.3451
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 182651206 (FF546837)
Gene Class Unknown
Domain Type
Gene Species Vigna unguiculata

Comment?

MOPDH51TF MOP Vigna unguiculata cDNA 5', mRNA sequence

DNA Sequence

GGACCATACTTCTCATCAATTTTCCCTTCGTTTTCTTCTACTTTCCCTTCCATTCCCTACCGACAACGTCGTCATCATCATCACCACCATGCCTTCTGCAGAATCATTGCCACCTTCCTCCCAAACCATCTGTGTCACCGGCGCCGGTGGCTTCATCGCGTCTTGGATGGTAAAACTTCTCTTGGAGAAAGGCTACACTGTGAGAGGAACACTCAGAAACCCAGATGATCCCAAGAACGGACACTTGAAAGAGTTCGAAGGAGCCTCCGAGAGACTAACTCTGCATAAGGTTGACCTCCTTGACGTTGACTCCGTTAGATCAGTAATCCACGGCTGCCATGGCGTCTTCCACACAGCTTCTCCCGTCACCGATAACCCCGAAGAAATGGTGGAGCCAGCGGTGAATGGAGCGAAGAATGTAATCATAGCAGCTGCAGAGGCAAAAGTGCGACGTGTGGTGTTCACCTCATCGATTGGTGCGGTATACATGGACCCTAAAAGGAGCATCGATTTGGTGGTTGACGAGTCTTGTTGGAGTGATTTAGAGTATTGCAAGAACACCAAGAATTGGTACTGCTATGGAAAGGCTGTGGCTGAAAAAGCAGCATGGGACACTGCGAAAGAGAAAGGAGTGGACTTGGTTGTGGTGAACCCAGTATTGGTTCTTGGACCACTGCTACAACCAACCATCAATGCCAGCACCATTCACATACTCAAGTACCTCACTGGCTCTGCTAAGACCTATGCAAATGCCACACAGCTTATGTGCATGTGAGGGATGTGGCATTGGCCCACATACTTGTTTATGAGAAATCTTCTGCTTCTGGTCGATACTTGTGTGCTGAAAGCTCCCTCCACCGTGGAGACTAGTTGAAATTCTCGC


Protein sequences

Name Description Sequence
Vun.3451 translated coding region predicted by ESTScan from UniGene Vun.3451

XDHTSHQFSLRFLLLSLPFPTDNVVIIITTMPSAESLPPSSQTICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKEFEGASERLTLHKVDLLDVDSVRSVIHGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAAAEAKVRRVVFTSSIGAVYMDPKRSIDLVVDESCWSDLEYCKNTKNWYCYGKAVAEKAAWDTAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTGSAKTYANATQLMCM

Domains

Domain Start-End Description Sequence

Seg: seg
8-20 seg

FSLRFLLLSLPFP

HMMPanther: PTHR10366:SF9
27-254 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

IITTMPSAESLPPSSQTICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKEFEGASERLTLHKVDLLDVDSVRSVIHGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAAAEAKVRRVVFTSSIGAVYMDPKRSIDLVVDESCWSDLEYCKNTKNWYCYGKAVAEKAAWDTAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTGSAKTYANATQ

HMMPanther: PTHR10366
27-254 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

IITTMPSAESLPPSSQTICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKEFEGASERLTLHKVDLLDVDSVRSVIHGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAAAEAKVRRVVFTSSIGAVYMDPKRSIDLVVDESCWSDLEYCKNTKNWYCYGKAVAEKAAWDTAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTGSAKTYANATQ

superfamily: SSF51735
31-258 NAD(P)-binding Rossmann-fold domains

MPSAESLPPSSQTICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKEFEGASERLTLHKVDLLDVDSVRSVIHGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAAAEAKVRRVVFTSSIGAVYMDPKRSIDLVVDESCWSDLEYCKNTKNWYCYGKAVAEKAAWDTAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTGSAKTYANATQLMCM

Gene3D: G3DSA:3.40.50.720
IPR016040
42-244 no description
NAD(P)-binding domain

QTICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKEFEGASERLTLHKVDLLDVDSVRSVIHGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAAAEAKVRRVVFTSSIGAVYMDPKRSIDLVVDESCWSDLEYCKNTKNWYCYGKAVAEKAAWDTAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTG

HMMPfam: PF01370
IPR001509
44-230 Epimerase
NAD-dependent epimerase/dehydratase

ICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKEFEGASERLTLHKVDLLDVDSVRSVIHGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAAAEAKVRRVVFTSSIGAVYMDPKRSIDLVVDESCWSDLEYCKNTKNWYCYGKAVAEKAAWDTAKEKGVDLVVVNPVLVLGPLLQPT

Seg: seg
98-109 seg

VDLLDVDSVRSV

Seg: seg
211-227 seg

GVDLVVVNPVLVLGPLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox