PRGDB00078316 (Vun.5571)

From PRG Wiki
Jump to: navigation, search
Vun.5571
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 182651702 (FF544953)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Vigna unguiculata

Comment?

MOPDL59TF MOP Vigna unguiculata cDNA 5', mRNA sequence

DNA Sequence

GGTAGCATTCAATAATCTTCAAGGGCCGGTACCCACAGGTGGTCAATTTGATACTTTCTCCTTTTCCAGCTTCGAAGGAAACCCACAGTTGTGTGGTTCAGTTGTTCGGCGGTCTTGTCTTCCCCAACAGGGTACTGCTGCACGTGGTCACAGCTCAAGCAAAAAGCTGATAATTGGATTTGCCATTGCAGCCAGTTTTGGGCTTGTTTCCTTGGTTTCAGTGTTGATAGTGTGGGTAATATCCAAGAGGAGGATCAATCCAGGTGGAGACCCTGATAAGATTGAAGTAGAATCAATCTCTATCAACTCTTACAGTGGGGTTCATCCCGAGGTTGACAAAGAGGCGAGCCAAGTGGTGCTGTTCCCTAATAAAACAAGTGAAATCAAGGACCTTACCATGGTTGAAATACTAAAAGCTACTGAAAACTTCAGTCAGGCAAACATAATAGGATGTGGGGGTTTTGGTTTGGTGTATAAAGCAACATTACCAAATGGAACTGCTCTGGCCATCAAGAAACTTTCAGGAGATTTGGGTCTTATGGAAAGGGAATTCAAAGCAGAGGTAGAGGCTCTGTCAACAGCACAGCATGAGAATCTGGTTGCATTGCAGGGCTACTGTGTGCATGAGGGTGTTCGGCTTCTCATATACACTTACATGGAAAATGGAAGTCTGGATTACTGGCTGCATGAGAAAACCGATGGTCCATCTCAGATTGATTGGCCTACTAGACTGAAGATTACAC


Protein sequences

Name Description Sequence
Vun.5571 translated coding region predicted by ESTScan from UniGene Vun.5571

XVAFNNLQGPVPTGGQFDTFSFSSFEGNPQLCGSVVRRSCLPQQGTAARGHSSSKKLIIGFAIAASFGLVSLVSVLIVWVISKRRINPGGDPDKIEVESISINSYSGVHPEVDKEASQVVLFPNKTSEIKDLTMVEILKATENFSQANIIGCGGFGLVYKATLPNGTALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMENGSLDYWLHEKTDGPSQIDWPTRLKITX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF478
2-247 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VAFNNLQGPVPTGGQFDTFSFSSFEGNPQLCGSVVRRSCLPQQGTAARGHSSSKKLIIGFAIAASFGLVSLVSVLIVWVISKRRINPGGDPDKIEVESISINSYSGVHPEVDKEASQVVLFPNKTSEIKDLTMVEILKATENFSQANIIGCGGFGLVYKATLPNGTALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMENGSLDYWLHEKTDGPSQIDWPTRLKI

HMMPanther: PTHR24420
2-247 FAMILY NOT NAMED,FAMILY NOT NAMED

VAFNNLQGPVPTGGQFDTFSFSSFEGNPQLCGSVVRRSCLPQQGTAARGHSSSKKLIIGFAIAASFGLVSLVSVLIVWVISKRRINPGGDPDKIEVESISINSYSGVHPEVDKEASQVVLFPNKTSEIKDLTMVEILKATENFSQANIIGCGGFGLVYKATLPNGTALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMENGSLDYWLHEKTDGPSQIDWPTRLKI

Gene3D: G3DSA:2.60.120.200
IPR013320
42-167 no description
Concanavalin A-like lectin/glucanase, subgroup

PQQGTAARGHSSSKKLIIGFAIAASFGLVSLVSVLIVWVISKRRINPGGDPDKIEVESISINSYSGVHPEVDKEASQVVLFPNKTSEIKDLTMVEILKATENFSQANIIGCGGFGLVYKATLPNGT

Seg: seg
69-82 seg

LVSLVSVLIVWVIS

superfamily: SSF56112
IPR011009
114-248 Protein kinase-like (PK-like)
Protein kinase-like domain

KEASQVVLFPNKTSEIKDLTMVEILKATENFSQANIIGCGGFGLVYKATLPNGTALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMENGSLDYWLHEKTDGPSQIDWPTRLKIT

ProfileScan: PS50011
IPR000719
144-249 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSQANIIGCGGFGLVYKATLPNGTALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMENGSLDYWLHEKTDGPSQIDWPTRLKITX

HMMPfam: PF07714
IPR001245
147-236 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ANIIGCGGFGLVYKATLPNGTALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMENGSLDYWLHEKTDGP

PatternScan: PS00107
IPR017441
150-173 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGCGGFGLVYKATLPNGTALAIKK

Gene3D: G3DSA:3.30.200.20
168-222 no description

ALAIKKLSGDLGLMEREFKAEVEALSTAQHENLVALQGYCVHEGVRLLIYTYMEN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox