PRGDB00078398 (Vun.13005)

From PRG Wiki
Jump to: navigation, search
Vun.13005
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 182652011 (FF546256)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Vigna unguiculata

Comment?

MOPCC16TF MOP Vigna unguiculata cDNA 5', mRNA sequence

DNA Sequence

GGTCTTGTGCGTCTTGCTCCGGAAGGAAAAGCATCTATAGAAACAAGAATTGCAGGAACTTTTGGATATTTGGCACCCGAGTATGCAGTGACCGGGCGTGTGACAACTAAAGTTGACGTGTTCAGCTTTGGGGTAATATTGATGGAGCTGATAACAGGAAGAAAAGCACTTGATGAGACACAACCCGAGGATAGCATGCACCTTGTAACATGGTTCCGCAGAATGTCCATAAACAAGGATTCATTCCGCAAGGCCATTGATTCCACCATCGATCTCAACGAGGAAACTCTGGCCAGTATTCACACCGTAGCAGAGTTAGCTGGCCACTGCTGTGCCAGGGAGCCATATCAAAGGCCTGACATGGGTCATACTGTTAACGTGCTTTCTTCTCTCGTTGAACTATGGAAACCCTCTGATCAGAATTCAGAAGATATATATGGCATTGACCTTGACATGTCCTTGCCACAAGCACTCAAGAAGTGGCAGGCTTATGAAGGTAGAAGTCAAATGGAGTCCTCTGCTTCATCTTCGCTTCTACCAAGCTTGGATAACACACAGACAAGTATACCTACTCGCCCATATGGATTTGCAGATTCTTTCACATCAGCAGATGGTAGGTGATCATGCTCGGTTGTAAATATTTGTTTTAGTGTGTTTGTTTATTCTCTCCAGTTCTTGCTTTTCTTTGTGAACTTGTTTATCTTTTTTCATGGTGTACTTCTCCTCCATGATTAATTTTACACCATCTTAGCCCTTTTT


Protein sequences

Name Description Sequence
Vun.13005 translated coding region predicted by ESTScan from UniGene Vun.13005

GLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHTVNVLSSLVELWKPSDQNSEDIYGIDLDMSLPQALKKWQAYEGRSQMESSASSSLLPSLDNTQTSIPTRPYGFADSFTSADGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-132 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHTVNVLSSLV

HMMPanther: PTHR24420:SF467
1-192 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHTVNVLSSLVELWKPSDQNSEDIYGIDLDMSLPQALKKWQAYEGRSQMESSASSSLLPSLDNTQTSIPTR

HMMPanther: PTHR24420
1-192 FAMILY NOT NAMED,FAMILY NOT NAMED

GLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHTVNVLSSLVELWKPSDQNSEDIYGIDLDMSLPQALKKWQAYEGRSQMESSASSSLLPSLDNTQTSIPTR

superfamily: SSF56112
IPR011009
1-151 Protein kinase-like (PK-like)
Protein kinase-like domain

GLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHTVNVLSSLVELWKPSDQNSEDIYGIDLD

Gene3D: G3DSA:1.10.510.10
2-124 no description

LVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHT

HMMPfam: PF00069
IPR017442
9-124 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GKASIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMSINKDSFRKAIDSTIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHT

Seg: seg
172-182 seg

SSASSSLLPSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox