PRGDB00078418 (Vun.14996)

From PRG Wiki
Jump to: navigation, search
Vun.14996
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 182657967 (FF551929)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Vigna unguiculata

Comment?

MOPG191TF MOP Vigna unguiculata cDNA 5', mRNA sequence

DNA Sequence

GGAAAAATCAGATGTGTATAGCTTTGGCATAGTTCTTTTGGAGCTACTAACTGGAAAGAAGGCAGTGGACAACGAGTGTAATTTGCATCAACTGATATTGGCGAAGACAGATAACAACACTGTGATGGAGGCTGTGGATGCAGAGGTGTCTATAACCTGCATTGATCTAGCTCATGTTAAGAAGACCTTTCAGCTTGCTTTGCTTTGCACGAAAAAGAACCCTTCTGAGAGGCCTACCATGCATGAAGTAGCAAGGGTTCTGGTATCGCTACTTCCTTCACCTCCAAGTAAGATTCTTGCTCCACCTGCGAAGAAGTTTGACTATGCCAATTTTGTGATCGAGAAGGGACAACCTCGAAAAGTGGAAGGACAACCTCACCAAGAAGATAACAACTCAACCAATGCTCGATGGTTTGTTCGCTTTGGGGATGTTATATCCAAGAGCACTTGATCACGACTCCTAGTTTCTACATATGTACCTGCTGAAGGATTCATGAGATTCACACTGGATGAAACTAGTTTCTTTTTGTGGTTTAGATATAATCGTTTACAGCATTTAACAAATAGATGGTGGAGCATATCGATAGGGGACAAAACACTTGACTATATTATAAGCATATGCAAGTTTCTAC


Protein sequences

Name Description Sequence
Vun.14996 translated coding region predicted by ESTScan from UniGene Vun.14996

XEKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPPSKILAPPAKKFDYANFVIEKGQPRKVEGQPHQEDNNSTNARWFVRFGDVISKST

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-92 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XEKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLL

Gene3D: G3DSA:1.10.510.10
2-119 no description

EKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPPSKILAPPAKKFDYANFVIEKGQP

HMMPanther: PTHR24420:SF825
2-98 SUBFAMILY NOT NAMED

EKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPPSK

HMMPanther: PTHR24420
2-98 FAMILY NOT NAMED,FAMILY NOT NAMED

EKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPPSK

superfamily: SSF56112
IPR011009
2-103 Protein kinase-like (PK-like)
Protein kinase-like domain

EKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPPSKILAPP

HMMPfam: PF07714
IPR001245
2-87 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EKSDVYSFGIVLLELLTGKKAVDNECNLHQLILAKTDNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox