PRGDB00078508 (Vvi.9)

From PRG Wiki
Jump to: navigation, search
Vvi.9
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225441671 (XM_002282659)
Gene Class Unknown
Domain Type LRR
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera polygalacturonase inhibiting protein (LOC100232865), mRNA

DNA Sequence

ATTCAGAGAAATGGAGACTTCAAAACTTTTTCTtctctcctcctctctcctcctagtcttactcgccactcgtccatgcccttctctctctgaacgttgcaacccaaaagacaaaaaagttctccttcaaatcaaaaaaGCCCTAGACAATCCCTACATTCTAGCTTCGTGGAATCCCAACACCGATTGCTGCGGATGGTACTGCGTCGAATGTGACCTCACCACCCACCGCATCAACTCGCTCACCATCTTCTCCGGCCAGCTATCCGGCCAGATTCCCGACGCTGTTGGTGACCTTCCGTTCCTCGAGACCCTCATCTTCCGCAAGCTCTCTAACCTCACCGGTCAGATCCCGCCGGCGATTGCCAAACTCAAGCACCTAAAAATGGTTCGCCTTAGCTGGACCAACCTCTCCGGTCCCGTGCCGGCGTTCTTCAGCGAGCTTAAGAACCTCACGTACCTCGACCTCTCCTTCAATAACCTATCTGGACCCATTCCCGGCAGCCTCTCTCTCCTCCCCAACCTCGGCGCACTCCATCTCGACCGGAACCACCTCACCGGCCCAATCCCTGACTCCTTCGGAAAATTCGCCGGCTCTACCCCAGGTCTACACCTCTCACACAACCAACTTTCCGGGAAAATCCCATATTCTTTCAGAGGATTCGACCCCAACGTCATGGACTTATCGCGTAACAAGCTTGAGGGTGACCTGTCAATATTCTTCAATGCCAATAAGTCAACACAGATCGTTGACTTCTCACGGAACTTGTTCCAGTTTGATCTTTCGAGAGTGGAATTCCCGAAGAGTTTGACGTCGTTGGACCTTTCGCATAACAAGATCGCCGGGAGCCTGCCGGAGATGATGACTTCTCTGGATTTACAGTTCCTGAACGTGAGTTACAATCGTTTGTGTGGTAAGATTCCGGTGGGTGGGAAGTTGCAGAGCTTCGATTACGACTCCTACTTTCACAATCGGTGCTTGTGTGGTGCTCCACTCCAGAGCTGCAAGTGACGGATTTGAGCTTCACATCTCTAAAATAAATGAATTGTGCTCATTTAAATATCAATTTCCCTAAAATAAATGAAACGGACATACAAGTCTATGAGTTCCATCGATCTAGAAGGAAATCTATTAGATT


Protein sequences

Name Description Sequence
Vvi.9 translated coding region predicted by ESTScan from UniGene Vvi.9

METSKLFLLSSSLLLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNVMDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCGAPLQSCK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF918
6-326 PTHR24420:SF918

LFLLSSSLLLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNVMDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCG

HMMPanther: PTHR24420
6-326 PTHR24420,FAMILY NOT NAMED

LFLLSSSLLLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNVMDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCG

superfamily: SSF52058
28-333 SSF52058,LRR

ERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNVMDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCGAPLQSCK

Gene3D: G3DSA:3.80.10.10
29-331 G3DSA:3.80.10.10

RCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNVMDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCGAPLQS

HMMPfam: PF08263
IPR013210
32-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECD

HMMPfam: PF13855
140-182 LRR_8,Leucine rich repeat

AFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHL

ProfileScan: PS51450
IPR001611
147-169 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSFNNLSGPIPGSLSLL

FPrintScan: PR00019
148-161 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSFNNLSGP

ProfileScan: PS51450
IPR001611
171-192 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLGALHLDRNHLTGPIPDSFGK

FPrintScan: PR00019
264-277 LEURICHRPT,Leucine-rich repeat signature

PKSLTSLDLSHNKI

HMMPfam: PF13516
265-277 LRR_6,Leucine Rich repeat

KSLTSLDLSHNKI

ProfileScan: PS51450
IPR001611
266-288 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLDLSHNKIAGSLPEMMTSL

ProfileScan: PS51450
IPR001611
289-311 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLQFLNVSYNRLCGKIPVGGKLQ

HMMPfam: PF00560
IPR001611
290-306 LRR_1
Leucine-rich repeat

LQFLNVSYNRLCGKIPV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox