PRGDB00078664 (Vvi.7279)

From PRG Wiki
Jump to: navigation, search
Vvi.7279
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225424830 (XM_002268322)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100263854 (LOC100263854), mRNA

DNA Sequence

ATGACGACCGACGCCGTTTCATCCACGCCGACAGCTTCAACTCCGGCAGTCAGACGCCGGTGGGACGTGTTCCTCAGTTTCAGAGGCGAAGACACTCGCGGCACCTTCACCGACTGTCTCTACACCCGTCTTCAGCATAAAGGCGTTCGAGCCTTTCGAGACAACGAAGGCTTGAACCGAGGTGATAAGATCGATCGTTGTCTACTCGACGCCATCGAGGACTCTGCGGCTTTCATTGCTATTATTTCACCCAATTACGCTAACTCTCGTTGGTGCCTGGAAGAACTCGCCAAGGTCTGCGAGTGCAACCGGCTCATTCTTCCCGTTTTCTACAACGTGGATCCTTCGCACGTCCGGGGACAGAGGGGGCCTTTCCTTCAACATTTTAAAGACCTGGAGGCACGGTTTGGTGAAGAGGATGTTTCGAAATGGAGAAAAGCTATGAAATATGTTGGCGGACTCGCCGGTTTTGTTGTCAATGGGTTTGGCGACGAAGCAGATGTGATTCAAACTTTGTTGAATAATGTTTTGGCTGAATTGAGCAAGTGGAGCGGTGTGGCTGCCTTTACTGTTGGACTCGATTCTCGTGTAGAAGAAGTGTTGGAGTTGTTAGACCTTAAATCCAACAGCATCAGAGTCTTAGGACTTTATGGACCAGGTGGGGTTGGTAAATCAACCCTTGCCAAGGCTCTTTATAATAAACTTGTCGCTCACTTTGAAAACCGCAGTTTCATTTCAAATGTCAAAAAATATTTGGCACAAGAAAATGGTCTGCTATCTCTCCAAATCAAACTCATTGGGGATCTTTCCGGTATGGCTTCACATGTAAATGAAGTTAATGCTGGTCTTGTTGCCATCAAAAGCATAGTCCAAGAGAAGCGAGTACTTATTATTTTAGACGATGTTGATGATGCAAGCCAACTCACGGCAATTGCTGGCAGGAAAAAATGGAGAAAATGGTTTTATGAAGGAAGTAGAATCATTATCACTACTAGAGATAGAGAGGTTCTGCATGAGCTTCATGAGAACGAGCTCTATGAGGTGAAACAGTTGAATTCCCCTGAGTCGCTACAACTTTTTAGTCACTATGCATTAGGGAGAGTGAAACCCACCCCAGACTACCTTCCTCTGTCCAAACAAATTGTATCTCTTACAGGAGGACTGCCCTTGGCTCTGGAAGTATTTGGTTCTTCTTTGTATGATAAGAGGAAAATAGAGGAATGGGAAGATGCTCTGCAAAAGTTAAAACAGATAAGGCCCATGGATCTTCAGGGTGTGTTAAAGATAAGTTATGACGGGCTGGATGAACAGGAGAAGTGTGTATTCCTTGATATTGCATGTTTGTTTATTAAAATGGGAATGAAGAAAGAAGATGCCATTGATATATTGAAGGGTTGTGGTTTCCGGGCTGAGATAGGAATAAAGGTACTTGTTGACAAATCTCTCCTTAAGATTGCAGAGGACTATACTTTGTGGATGCATGACCAGCTTAGAGACATGGGAAGACAAATCGTTCTGCATGAAAACCATGAAGATCTTGGAATGCGTAGCAGGCTGTGGGATCGCAGTGAGATTTTGCGTGTCTTGCAGAATAACTTGGGATCAAGATGTATTCAAGGTATGGTCCTAGATTTTGTGAGTGATATCTTTATGAAGGATTCTGCTGCTGCTTGGGGTCGCTTTAGAGGAACACCCAATTTCACCACAGCAGTTACATGGCTAAAGGAAACATATAAGGAATATTTTCAACATGCAGCAGAGAAAGAGAGGGAATTGATACTTCAAACTAAGTCATTTGAATCCATGATTAACCTAAGACTGCTTCAAATCGATAATGTACAATTAGAAGGAGAATTCAAACTCATGCCTGCAGAACTGAAGTGGCTACAATGGAGAGGATGCCCTTTGAAAACTCTTCCTTCTGATTTCTGTCCTCAAGGACTTAGGGTCCTAGATCTTTCCGAAAGCAAGAATATTGAGCGACTGTGGGGCGGCAGATGGTGGAGCTGGCACAATAACAAGGTGGGTGAGAACTTGATGGTCATGAATCTCCATGGTTGCTGTAATTTAACTGCCATTCCAGATTTATCTGGAAATCAAGCCTTGGAAAAGTTGATTCTTCAGCATTGCCATGGCCTAGTTAAGATTCATAAGTCGATCGGGGACATCATTAGTTTACTTCATTTGGACCTGAGCGAATGTAAGAACCTTGTTGAATTTCCAAGTGATGTCTCTGGGCTGAAAAATCTCCAGACCCTTATCCTCTCTGGTTGCTCCAAACTGAAGGAATTACCAGAGAACATAAGCTACATGAAATCTTTAAGAGAACTCCTTCTTGATGGAACTGTTATAGAGAAGCTACCTGAATCTGTACTCCGTCTCACAAGACTTGAAAGGCTTAGTCTAAATAATTGCCAGTCATTAAAGCAATTACCTACATGCATAGGCAAGCTGGAATCCCTTAGAGAACTTTCATTTAATGATTCTGCTTTAGAAGAAATACCTGATTCCTTCGGATCTTTGACAAACCTTGAGAGACTAAGTTTGATGAGGTGTCAATCCATCTATGCAATTCCTGATTCTGTCCGCAATCTCAAATTGTTGACAGAATTTTTAATGAATGGTAGCCCAGTCAATGAATTGCCCGCTTCTATCGGTTCATTATCCAACCTGAAGGACTTATCAGTTGGTCATTGTAGATTTCTGAGCAAATTGCCTGCTTCAATTGAAGGATTAGCTTCAATGGTTGTGCTTCAGTTGGATGGGACATCAATCATGGACCTACCAGATCAGATTGGTGGATTGAAAACACTTAGGAGGCTTGAGATGAGGTTCTGTAAACGTCTTGAATCATTGCCAGAAGCAATTGGAAGCATGGGGTCTCTTAATACTTTGATCATTGTGGATGCCCCCATGACTGAGTTGCCAGAATCCATAGGGAAGTTAGAAAATCTCATCATGCTAAATTTGAACAAGTGTAAACGGCTACGCAGATTGCCAGGTTCAATCGGGAATTTGAAGTCATTGCATCACTTGAAAATGGAGGAAACTGCTGTTAGGCAACTACCTGAAAGTTTTGGGATGCTCACAAGCTTAATGAGATTGTTAATGGCAAAGCGGCCTCATCTTGAGCTGCCCCAAGCCCTTGGACCAACAGAGACAAAAGTCCTTGGTGCAGAAGAGAATTCGGAGCTCATTGTACTTCCAACTTCTTTCTCAAATCTCTCCTTGTTGTATGAATTGGATGCTCGCGCTTGGAAAATATCTGGTAAAATTCCTGATGATTTTGATAAGCTGTCATCGTTGGAGATTTTGAATCTTGGTCGTAATAACTTCAGCAGTCTTCCGTCTAGTCTGAGGGGCCTTTCCATTCTCAGAAAGCTTCTTTTGCCCCATTGTGAAGAGCTCAAGGCTCTCCCTCCACTTCCCTCAAGTTTGATGGAGGTGAATGCTGCAAACTGTTATGCTTTGGAAGTTATATCTGATCTGTCAAACTTGGAGAGTTTACAAGAGCTGAATCTTACAAACTGTAAGAAATTAGTGGATATTCCAGGCGTTGAATGCTTGAAGTCATTGAAAGGTTTCTTTATGAGTGGTTGCAGTTCATGCTCTTCCACGGTAAAGAGAAGACTCAGTAAGGTTGCTTTGAAGAATTTGCGCACTTTAAGTATTCCTGGAAGCAATATCCCAGACTGGTTTTCTCGCAATGTTGCCATTTTCTCAAAGCGCAAAAACCTTGTAATCAAAGCTGTGATTATAGGAGTTGTGGTCTCTCTCAGCCATCACATACAGGACGAATTAAGAGATCAACTTCCCTCAGTCCCAGGCATCGAAGCGAAGATCCTTAGAATGAACAGACAGGTATTTGGCACCATGCTGGACTTAACAGGAGTACCAAAGACGGATGAAGATCATCTATACTTGTGTAGATATCGTGAGTTTCACCCCATAGTCTCTATGCTGAAAGATGGCGATAAGATACAGGTGACAATGAGAAATCCACCGATGGTTAAAGGGGTAGAGCTGAAGAAATCTGGGATTCATCTGATTTTCGAAAATGATGATGATTACGATGAAGATGAGAGATCATTTGATGAAAACCTACAAACTGTATCAGAAAAAATAGCAAGATTTTTTGGTCCTTCTGAAGGAGGTAATAGCATCTCTGACTCCATAGATGAGGTCGAACGAGAAAAGCAGGAAATGGGAATGAAAGAGGAATGGAAGGAAGAGAAGAAGGGCCGTGATGGTAGCCATAGAAgttcatttcttcttttcttcttcattgcccttccttccttctttctGTTGTTGAGTTGGTCGTGGACACGCGGCTAGTGTTGGTTTTCTTTCAAGTGCCTTGTTGGGTTCCCCACGTTTCCAAGACTGCTTGTCAGTGTAAATTATTTATAATATTTTATCACATTAATTTTCATACTAAAATTTTATGCTCTTTTATAAAACATTTTGTTATATTGTTTTATTAA


Protein sequences

Name Description Sequence
Vvi.7279 translated coding region predicted by ESTScan from UniGene Vvi.7279

MTTDAVSSTPTASTPAVRRRWDVFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKYVGGLAGFVVNGFGDEADVIQTLLNNVLAELSKWSGVAAFTVGLDSRVEEVLELLDLKSNSIRVLGLYGPGGVGKSTLAKALYNKLVAHFENRSFISNVKKYLAQENGLLSLQIKLIGDLSGMASHVNEVNAGLVAIKSIVQEKRVLIILDDVDDASQLTAIAGRKKWRKWFYEGSRIIITTRDREVLHELHENELYEVKQLNSPESLQLFSHYALGRVKPTPDYLPLSKQIVSLTGGLPLALEVFGSSLYDKRKIEEWEDALQKLKQIRPMDLQGVLKISYDGLDEQEKCVFLDIACLFIKMGMKKEDAIDILKGCGFRAEIGIKVLVDKSLLKIAEDYTLWMHDQLRDMGRQIVLHENHEDLGMRSRLWDRSEILRVLQNNLGSRCIQGMVLDFVSDIFMKDSAAAWGRFRGTPNFTTAVTWLKETYKEYFQHAAEKERELILQTKSFESMINLRLLQIDNVQLEGEFKLMPAELKWLQWRGCPLKTLPSDFCPQGLRVLDLSESKNIERLWGGRWWSWHNNKVGENLMVMNLHGCCNLTAIPDLSGNQALEKLILQHCHGLVKIHKSIGDIISLLHLDLSECKNLVEFPSDVSGLKNLQTLILSGCSKLKELPENISYMKSLRELLLDGTVIEKLPESVLRLTRLERLSLNNCQSLKQLPTCIGKLESLRELSFNDSALEEIPDSFGSLTNLERLSLMRCQSIYAIPDSVRNLKLLTEFLMNGSPVNELPASIGSLSNLKDLSVGHCRFLSKLPASIEGLASMVVLQLDGTSIMDLPDQIGGLKTLRRLEMRFCKRLESLPEAIGSMGSLNTLIIVDAPMTELPESIGKLENLIMLNLNKCKRLRRLPGSIGNLKSLHHLKMEETAVRQLPESFGMLTSLMRLLMAKRPHLELPQALGPTETKVLGAEENSELIVLPTSFSNLSLLYELDARAWKISGKIPDDFDKLSSLEILNLGRNNFSSLPSSLRGLSILRKLLLPHCEELKALPPLPSSLMEVNAANCYALEVISDLSNLESLQELNLTNCKKLVDIPGVECLKSLKGFFMSGCSSCSSTVKRRLSKVALKNLRTLSIPGSNIPDWFSRNVAIFSKRKNLVIKAVIIGVVVSLSHHIQDELRDQLPSVPGIEAKILRMNRQVFGTMLDLTGVPKTDEDHLYLCRYREFHPIVSMLKDGDKIQVTMRNPPMVKGVELKKSGIHLIFENDDDYDEDERSFDENLQTVSEKIARFFGPSEGGNSISDSIDEVEREKQEMGMKEEWKEEKKGRDGSHRSSFLLFFFIALPSFFLLLSWSW

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
9-157 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

TPTASTPAVRRRWDVFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKYVGGLAGF

ProfileScan: PS50104
IPR000157
19-154 TIR
Toll-Interleukin receptor

RRWDVFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKYVGGL

Gene3D: G3DSA:3.40.50.10140
19-150 no description

RRWDVFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKY

HMMSmart: SM00255
IPR000157
20-154 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RWDVFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKYVGGL

HMMPfam: PF01582
IPR000157
23-149 TIR
Toll-Interleukin receptor

VFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMK

HMMPanther: PTHR23155:SF303
32-1183 ATP BINDING / PROTEIN BINDING / TRANSMEMBRANE RECEPTOR

TRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKYVGGLAGFVVNGFGDEADVIQTLLNNVLAELSKWSGVAAFTVGLDSRVEEVLELLDLKSNSIRVLGLYGPGGVGKSTLAKALYNKLVAHFENRSFISNVKKYLAQENGLLSLQIKLIGDLSGMASHVNEVNAGLVAIKSIVQEKRVLIILDDVDDASQLTAIAGRKKWRKWFYEGSRIIITTRDREVLHELHENELYEVKQLNSPESLQLFSHYALGRVKPTPDYLPLSKQIVSLTGGLPLALEVFGSSLYDKRKIEEWEDALQKLKQIRPMDLQGVLKISYDGLDEQEKCVFLDIACLFIKMGMKKEDAIDILKGCGFRAEIGIKVLVDKSLLKIAEDYTLWMHDQLRDMGRQIVLHENHEDLGMRSRLWDRSEILRVLQNNLGSRCIQGMVLDFVSDIFMKDSAAAWGRFRGTPNFTTAVTWLKETYKEYFQHAAEKERELILQTKSFESMINLRLLQIDNVQLEGEFKLMPAELKWLQWRGCPLKTLPSDFCPQGLRVLDLSESKNIERLWGGRWWSWHNNKVGENLMVMNLHGCCNLTAIPDLSGNQALEKLILQHCHGLVKIHKSIGDIISLLHLDLSECKNLVEFPSDVSGLKNLQTLILSGCSKLKELPENISYMKSLRELLLDGTVIEKLPESVLRLTRLERLSLNNCQSLKQLPTCIGKLESLRELSFNDSALEEIPDSFGSLTNLERLSLMRCQSIYAIPDSVRNLKLLTEFLMNGSPVNELPASIGSLSNLKDLSVGHCRFLSKLPASIEGLASMVVLQLDGTSIMDLPDQIGGLKTLRRLEMRFCKRLESLPEAIGSMGSLNTLIIVDAPMTELPESIGKLENLIMLNLNKCKRLRRLPGSIGNLKSLHHLKMEETAVRQLPESFGMLTSLMRLLMAKRPHLELPQALGPTETKVLGAEENSELIVLPTSFSNLSLLYELDARAWKISGKIPDDFDKLSSLEILNLGRNNFSSLPSSLRGLSILRKLLLPHCEELKALPPLPSSLMEVNAANCYALEVISDLSNLESLQELNLTNCKKLVDI

HMMPanther: PTHR23155
32-1183 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLDAIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFKDLEARFGEEDVSKWRKAMKYVGGLAGFVVNGFGDEADVIQTLLNNVLAELSKWSGVAAFTVGLDSRVEEVLELLDLKSNSIRVLGLYGPGGVGKSTLAKALYNKLVAHFENRSFISNVKKYLAQENGLLSLQIKLIGDLSGMASHVNEVNAGLVAIKSIVQEKRVLIILDDVDDASQLTAIAGRKKWRKWFYEGSRIIITTRDREVLHELHENELYEVKQLNSPESLQLFSHYALGRVKPTPDYLPLSKQIVSLTGGLPLALEVFGSSLYDKRKIEEWEDALQKLKQIRPMDLQGVLKISYDGLDEQEKCVFLDIACLFIKMGMKKEDAIDILKGCGFRAEIGIKVLVDKSLLKIAEDYTLWMHDQLRDMGRQIVLHENHEDLGMRSRLWDRSEILRVLQNNLGSRCIQGMVLDFVSDIFMKDSAAAWGRFRGTPNFTTAVTWLKETYKEYFQHAAEKERELILQTKSFESMINLRLLQIDNVQLEGEFKLMPAELKWLQWRGCPLKTLPSDFCPQGLRVLDLSESKNIERLWGGRWWSWHNNKVGENLMVMNLHGCCNLTAIPDLSGNQALEKLILQHCHGLVKIHKSIGDIISLLHLDLSECKNLVEFPSDVSGLKNLQTLILSGCSKLKELPENISYMKSLRELLLDGTVIEKLPESVLRLTRLERLSLNNCQSLKQLPTCIGKLESLRELSFNDSALEEIPDSFGSLTNLERLSLMRCQSIYAIPDSVRNLKLLTEFLMNGSPVNELPASIGSLSNLKDLSVGHCRFLSKLPASIEGLASMVVLQLDGTSIMDLPDQIGGLKTLRRLEMRFCKRLESLPEAIGSMGSLNTLIIVDAPMTELPESIGKLENLIMLNLNKCKRLRRLPGSIGNLKSLHHLKMEETAVRQLPESFGMLTSLMRLLMAKRPHLELPQALGPTETKVLGAEENSELIVLPTSFSNLSLLYELDARAWKISGKIPDDFDKLSSLEILNLGRNNFSSLPSSLRGLSILRKLLLPHCEELKALPPLPSSLMEVNAANCYALEVISDLSNLESLQELNLTNCKKLVDI

superfamily: SSF52540
178-423 P-loop containing nucleoside triphosphate hydrolases

AELSKWSGVAAFTVGLDSRVEEVLELLDLKSNSIRVLGLYGPGGVGKSTLAKALYNKLVAHFENRSFISNVKKYLAQENGLLSLQIKLIGDLSGMASHVNEVNAGLVAIKSIVQEKRVLIILDDVDDASQLTAIAGRKKWRKWFYEGSRIIITTRDREVLHELHENELYEVKQLNSPESLQLFSHYALGRVKPTPDYLPLSKQIVSLTGGLPLALEVFGSSLYDKRKIEEWEDALQKLKQIRPMDL

HMMPfam: PF00931
IPR002182
194-468 NB-ARC,NBS
NB-ARC

DSRVEEVLELLDLKSNSIRVLGLYGPGGVGKSTLAKALYNKLVAHFENRSFISNVKKYLAQENGLLSLQIKLIGDLSGMASHVNEVNAGLVAIKSIVQEKRVLIILDDVDDASQLTAIAGRKKWRKWFYEGSRIIITTRDREVLHELHENELYEVKQLNSPESLQLFSHYALGRVKPTPDYLPLSKQIVSLTGGLPLALEVFGSSLYDKRKIEEWEDALQKLKQIRPMDLQGVLKISYDGLDEQEKCVFLDIACLFIKMGMKKEDAIDILKGCGF

ProfileScan: PS51450
IPR001611
200-221 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLELLDLKSNSIRVLGLYGPGG

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

VLGLYGPGGVGKSTLA

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

IVQEKRVLIILDDVD

Gene3D: G3DSA:3.40.50.300
292-306 no description

EKRVLIILDDVDDAS

Gene3D: G3DSA:3.40.50.300
321-357 no description

FYEGSRIIITTRDREVLHELHENELYEVKQLNSPESL

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

TGGLPLALEVFGSSL

superfamily: SSF52058
492-929 L domain-like,LRR

WMHDQLRDMGRQIVLHENHEDLGMRSRLWDRSEILRVLQNNLGSRCIQGMVLDFVSDIFMKDSAAAWGRFRGTPNFTTAVTWLKETYKEYFQHAAEKERELILQTKSFESMINLRLLQIDNVQLEGEFKLMPAELKWLQWRGCPLKTLPSDFCPQGLRVLDLSESKNIERLWGGRWWSWHNNKVGENLMVMNLHGCCNLTAIPDLSGNQALEKLILQHCHGLVKIHKSIGDIISLLHLDLSECKNLVEFPSDVSGLKNLQTLILSGCSKLKELPENISYMKSLRELLLDGTVIEKLPESVLRLTRLERLSLNNCQSLKQLPTCIGKLESLRELSFNDSALEEIPDSFGSLTNLERLSLMRCQSIYAIPDSVRNLKLLTEFLMNGSPVNELPASIGSLSNLKDLSVGHCRFLSKLPASIEGLASMVVLQLDGTSIMDLP

Gene3D: G3DSA:3.80.10.10
595-798 no description

QTKSFESMINLRLLQIDNVQLEGEFKLMPAELKWLQWRGCPLKTLPSDFCPQGLRVLDLSESKNIERLWGGRWWSWHNNKVGENLMVMNLHGCCNLTAIPDLSGNQALEKLILQHCHGLVKIHKSIGDIISLLHLDLSECKNLVEFPSDVSGLKNLQTLILSGCSKLKELPENISYMKSLRELLLDGTVIEKLPESVLRLTRLE

ProfileScan: PS51450
IPR001611
678-700 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLMVMNLHGCCNLTAIPDLSGNQ

FPrintScan: PR00364
IPR000767
745-761 DISEASERSIST
Disease resistance protein

SGLKNLQTLILSGCSKL

HMMSmart: SM00369
IPR003591
747-770 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLQTLILSGCSKLKELPENISY

HMMPfam: PF00560
IPR001611
749-769 LRR_1
Leucine-rich repeat

NLQTLILSGCSKLKELPENIS

ProfileScan: PS51450
IPR001611
749-771 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLILSGCSKLKELPENISYM

HMMSmart: SM00369
IPR003591
771-794 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLRELLLDGTVIEKLPESVLRL

ProfileScan: PS51450
IPR001611
773-794 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRELLLDGTVIEKLPESVLRL

Gene3D: G3DSA:3.80.10.10
799-870 no description

RLSLNNCQSLKQLPTCIGKLESLRELSFNDSALEEIPDSFGSLTNLERLSLMRCQSIYAIPDSVRNLKLLTE

HMMSmart: SM00369
IPR003591
818-841 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LESLRELSFNDSALEEIPDSFGSL

ProfileScan: PS51450
IPR001611
820-841 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRELSFNDSALEEIPDSFGSL

Gene3D: G3DSA:3.80.10.10
871-1040 no description

FLMNGSPVNELPASIGSLSNLKDLSVGHCRFLSKLPASIEGLASMVVLQLDGTSIMDLPDQIGGLKTLRRLEMRFCKRLESLPEAIGSMGSLNTLIIVDAPMTELPESIGKLENLIMLNLNKCKRLRRLPGSIGNLKSLHHLKMEETAVRQLPESFGMLTSLMRLLMAKR

HMMSmart: SM00369
IPR003591
912-935 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LASMVVLQLDGTSIMDLPDQIGGL

superfamily: SSF52047
927-1278 RNI-like,LRR

DLPDQIGGLKTLRRLEMRFCKRLESLPEAIGSMGSLNTLIIVDAPMTELPESIGKLENLIMLNLNKCKRLRRLPGSIGNLKSLHHLKMEETAVRQLPESFGMLTSLMRLLMAKRPHLELPQALGPTETKVLGAEENSELIVLPTSFSNLSLLYELDARAWKISGKIPDDFDKLSSLEILNLGRNNFSSLPSSLRGLSILRKLLLPHCEELKALPPLPSSLMEVNAANCYALEVISDLSNLESLQELNLTNCKKLVDIPGVECLKSLKGFFMSGCSSCSSTVKRRLSKVALKNLRTLSIPGSNIPDWFSRNVAIFSKRKNLVIKAVIIGVVVSLSHHIQDELRDQLPSVPGIE

Seg: seg
988-999 seg

LNLNKCKRLRRL

HMMSmart: SM00369
IPR003591
1006-1028 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLHHLKMEETAVRQLPESFGM

Gene3D: G3DSA:3.80.10.10
1045-1229 no description

LPQALGPTETKVLGAEENSELIVLPTSFSNLSLLYELDARAWKISGKIPDDFDKLSSLEILNLGRNNFSSLPSSLRGLSILRKLLLPHCEELKALPPLPSSLMEVNAANCYALEVISDLSNLESLQELNLTNCKKLVDIPGVECLKSLKGFFMSGCSSCSSTVKRRLSKVALKNLRTLSIPGSNI

HMMSmart: SM00369
IPR003591
1099-1122 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEILNLGRNNFSSLPSSLRGL

HMMPfam: PF00560
IPR001611
1101-1122 LRR_1
Leucine-rich repeat

SLEILNLGRNNFSSLPSSLRGL

ProfileScan: PS51450
IPR001611
1101-1123 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILNLGRNNFSSLPSSLRGLS

Seg: seg
1117-1130 seg

SSLRGLSILRKLLL

Seg: seg
1163-1174 seg

LSNLESLQELNL

HMMPfam: PF00560
IPR001611
1168-1185 LRR_1
Leucine-rich repeat

SLQELNLTNCKKLVDIPG

ProfileScan: PS51450
IPR001611
1168-1190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQELNLTNCKKLVDIPGVECLK

Seg: seg
1194-1205 seg

GFFMSGCSSCSS

Seg: seg
1352-1366 seg

ENDDDYDEDERSFDE

Seg: seg
1398-1414 seg

EKQEMGMKEEWKEEKKG

Seg: seg
1433-1442 seg

SFFLLLSWSW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox