PRGDB00078669 (Vvi.7658)

From PRG Wiki
Jump to: navigation, search
Vvi.7658
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225454249 (XM_002274957)
Gene Class CN
Domain Type NBS, Ser-Thr Kinase
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100243070 (LOC100243070), mRNA

DNA Sequence

ATGGCCGTGGTGAGTCCAGTTCCGGCAATTTCACAGCAGCTTGATCACGTACGGTTACATGAAATTGGGGTCTCTGCGGTGATGTCAAGCACTGGAGAAATCGTGGAGGAACAGCCGCTGGCTCTTGTGGTCGAAGATAAGATATTTGTGGCAGTTGGCAAAGAAGTGAAGGAGAGTAAATCGATTCTGGTGTGGGCGTTACAGAACTCTGGAGGCAAAAGAATTAGTATAGTTCATGTTCATCAGCCGGCCCAGATGATCCCTATAATGGGTGGGAAATTTCCTGCCAGCAAACTGAAGGAGCAGGAGGTCAAAGCCTACCGAGATCTTGAGAGGCAAGATATGCACAAGATTCTAAATGACTACCTTCTCATTTGTAGGAAAGCAGGGGTGAGAGCGGAGAAACTGTATATCGAGTCAGAGAATGTGGAGAAGGGTATTTTGGAACTCATTTCTGAACATGGGATCAAGAAACTGGTCGTGGGTGCAGCAGCGGATAAGCACTACTCAAGGAGAATGTTAGAGCCGAAGTCAAAGAAGGCAGCATATGTGCGGGATAAGGCTCCTTTATTCTGTCATATTTGGTTCGTATGCAGGGGGCACCTCATCTACACAAGGGAAGGTAGCTTGAATGGGGCTGATATAGAGCTCAGAACACCTCCATCACAGCAAGCGAGTCCAAACAATGAAACAGGGCAATCAAATACCTTCAGATCAATGTCCGTATCTCTGGGGCAGAATCATCCATCAAAACTTGTCAATCCAGGTCAAGACTTACCCAGAACAATGTCAGTCCCCGTGAGAATTACAGTGCTTTCTTCCCCTGATGGTACTGGAGGGGTGTCTGCACCATGGAGCAGGATGGGTAGGGAAGGGAGTTCCGACTATTGGGATGGGATATCAAAGAGAAGTCCTTCTCAGGCTTCAGGTTTTTCTACGTGCTCCTCAGGTGACATGGCTGGTGAGGTAAATGAAGATGGATTAGAGTCACGTGCGTCTCCTGTAGCCAAGCAGGCTCTTCACCATTCATCTCCTCCCAGTGTACTGGAAGAAAATATTTATGATCAACTTGAGCAAGCAATGGTGGAAGCTGAAAATTCCAGGCGGGAAGCTTTTCAAGAGTCTCTTAGGCGCAGCAAAGCTGAAAAAGATGCTATTGAGGCTATTCGCAGGGCTAAAAAAGCCGAAAGATCATTTAGTGAGGAGTTGAAACTGCGGAGAGACATTGAGGAGGCATTACAAGCCCAAGGAAAAGAACTTGAAAGCCTGAGGAACAAGCAACAAGAAATCATGGAAGAACTGAAGATTTCTTTGAATCATAAGTCGCTTCTGGAGAATCAAATTGCAGATTCTGAGCAGGTGGTAAAGGAGTTGGAGGAGAAGATTATCGCTGCCGTGGAGCTGTTACAGAATTACAAGAAAGAACGGGATGAGTTGCAGATTGAGCGTGACAATGCAATCAAAACAGCTGAGGAACTCAAGAAAAAGGGAGCATCAACTTCACATACGCCTCAGTACTTTGCTGAGTTCTCTTTTGCAGAAATTGAGAAAGCAACTCAGAACTTTGATCCATCAGTGAAAATTGGGGAAGGGGGGTATGGAAGCATTTACAAAGGTTGCCTGCGCCATACCCAAGTGGCAATAAAGATGCTGCATTCTGATAGCTTCCAAGGCCCAACAGAATTTCAACAGGAGGTCGACATTTTGAGTAAGTTGAGGCATCCAAATTTGGTAACTCTCATAGGTGCTTGCCCAGAAGCCTGGGCACTCATCTATGAGTATCTTCCAAATGGAAGCCTGGAAGACCGACTCAACTGCAGGGACAACACTCCCCCACTGTCATGGCAAGCTCGTATTCGCATTGCAGCAGAGCTATGCTCCGTGCTCATCTTCCTTCATTCCAATAATCCTGACAGTATAGTGCATGGAGATTTGAAGCCTAGCAATATTCTTCTGGATGCCAACTTTGGGAGCAAGCTTAGCGACTTTGGAATCTGTCGTGTGATCTCTCATGATGGAAATTCGAGCAACAGTGCAACCATGTGTTGCAGAACTGGCCCAAAGGGAACTTTTGCCTATATGGATCCTGAGTTCCTCTCTTCAGGGGAGCTCACTGTAAAGTCAGATGTATACTCATTCGGAATTATATTATTACGGTTGTTAACTGGGAAACCAGCAATTGGGATCACAAAAGAAGTGCAACATGCATTAGATCAGGGAAATTTGAACACCCTGTTGGATCCCTTGGCTGGGGACTGGCCCTTTGTGCAGGCTAAGCAGTTGGCTCTCATGGCACTGAGGTGCTGTGAGATGAACAGGAAGAGCAGGCCAGACCTTGTCTCAGAAGTATGGAGGGTGCTTGAACCCATGAAGGTTTCATGTGGAGCTTCATCATCATCATTTCGGGTCGGTTCTGAAGAGCGTGGCCAGATTCCACCCTACTTCATTTGTCCCATTTTCCAGGAAATCATGCAAGACCCTTGTGTGGCAGCTGATGGGTTCACCTATGAGGCCGAGGCTCTGCGAGGATGGCTTGATGGCGGCCACAGCACTTCACCCATGACAAACCTGAAGCTTGGTCACCTGAATCTTGTCCCCAACCGGGCTCTTCGCTCTGCAATTCAGGAGTGGTTGCAGCAGCCCTGAACATTTATATATATCTACATACACCATTTTGTATTCTTCATAATGTCTATACTAAACTTAtttttttcttttcctttttttCTCTTCTCGTCTTTCACCATTTTGTTTCCTTATGAGATTCTGGAGTATGTATAAGCATTATATTCTAATTACATTGTACAGAAAAGCAGCATGTTCATGtatttatataattatatttttatataAAGTGTAGGCTTATTAGACTTA


Protein sequences

Name Description Sequence
Vvi.7658 translated coding region predicted by ESTScan from UniGene Vvi.7658

MAVVSPVPAISQQLDHVRLHEIGVSAVMSSTGEIVEEQPLALVVEDKIFVAVGKEVKESKSILVWALQNSGGKRISIVHVHQPAQMIPIMGGKFPASKLKEQEVKAYRDLERQDMHKILNDYLLICRKAGVRAEKLYIESENVEKGILELISEHGIKKLVVGAAADKHYSRRMLEPKSKKAAYVRDKAPLFCHIWFVCRGHLIYTREGSLNGADIELRTPPSQQASPNNETGQSNTFRSMSVSLGQNHPSKLVNPGQDLPRTMSVPVRITVLSSPDGTGGVSAPWSRMGREGSSDYWDGISKRSPSQASGFSTCSSGDMAGEVNEDGLESRASPVAKQALHHSSPPSVLEENIYDQLEQAMVEAENSRREAFQESLRRSKAEKDAIEAIRRAKKAERSFSEELKLRRDIEEALQAQGKELESLRNKQQEIMEELKISLNHKSLLENQIADSEQVVKELEEKIIAAVELLQNYKKERDELQIERDNAIKTAEELKKKGASTSHTPQYFAEFSFAEIEKATQNFDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRVLEPMKVSCGASSSSFRVGSEERGQIPPYFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEWLQQP

Domains

Domain Start-End Description Sequence

superfamily: SSF52402
46-180 Adenine nucleotide alpha hydrolases-like

DKIFVAVGKEVKESKSILVWALQNSGGKRISIVHVHQPAQMIPIMGGKFPASKLKEQEVKAYRDLERQDMHKILNDYLLICRKAGVRAEKLYIESENVEKGILELISEHGIKKLVVGAAADKHYSRRMLEPKSKK

Gene3D: G3DSA:3.40.50.620
IPR014729
47-173 no description
Rossmann-like alpha/beta/alpha sandwich fold

KIFVAVGKEVKESKSILVWALQNSGGKRISIVHVHQPAQMIPIMGGKFPASKLKEQEVKAYRDLERQDMHKILNDYLLICRKAGVRAEKLYIESENVEKGILELISEHGIKKLVVGAAADKHYSRRM

HMMPanther: PTHR24420:SF448
172-857 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RMLEPKSKKAAYVRDKAPLFCHIWFVCRGHLIYTREGSLNGADIELRTPPSQQASPNNETGQSNTFRSMSVSLGQNHPSKLVNPGQDLPRTMSVPVRITVLSSPDGTGGVSAPWSRMGREGSSDYWDGISKRSPSQASGFSTCSSGDMAGEVNEDGLESRASPVAKQALHHSSPPSVLEENIYDQLEQAMVEAENSRREAFQESLRRSKAEKDAIEAIRRAKKAERSFSEELKLRRDIEEALQAQGKELESLRNKQQEIMEELKISLNHKSLLENQIADSEQVVKELEEKIIAAVELLQNYKKERDELQIERDNAIKTAEELKKKGASTSHTPQYFAEFSFAEIEKATQNFDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRVLEPMKVSCGASSSSFRVGSEERGQIPPYFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNL

HMMPanther: PTHR24420
172-857 FAMILY NOT NAMED,FAMILY NOT NAMED

RMLEPKSKKAAYVRDKAPLFCHIWFVCRGHLIYTREGSLNGADIELRTPPSQQASPNNETGQSNTFRSMSVSLGQNHPSKLVNPGQDLPRTMSVPVRITVLSSPDGTGGVSAPWSRMGREGSSDYWDGISKRSPSQASGFSTCSSGDMAGEVNEDGLESRASPVAKQALHHSSPPSVLEENIYDQLEQAMVEAENSRREAFQESLRRSKAEKDAIEAIRRAKKAERSFSEELKLRRDIEEALQAQGKELESLRNKQQEIMEELKISLNHKSLLENQIADSEQVVKELEEKIIAAVELLQNYKKERDELQIERDNAIKTAEELKKKGASTSHTPQYFAEFSFAEIEKATQNFDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRVLEPMKVSCGASSSSFRVGSEERGQIPPYFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNL

Coil: coil
350-399 coiled-coil

EENIYDQLEQAMVEAENSRREAFQESLRRSKAEKDAIEAIRRAKKAERSF

Coil: coil
406-434 coiled-coil

RRDIEEALQAQGKELESLRNKQQEIMEEL

Coil: coil
441-497 coiled-coil

KSLLENQIADSEQVVKELEEKIIAAVELLQNYKKERDELQIERDNAIKTAEELKKKG

superfamily: SSF56112
IPR011009
494-792 Protein kinase-like (PK-like)
Protein kinase-like domain

KKKGASTSHTPQYFAEFSFAEIEKATQNFDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRVLEPMKV

Gene3D: G3DSA:3.30.200.20
503-581 no description

TPQYFAEFSFAEIEKATQNFDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLI

ProfileScan: PS50011
IPR000719
522-791 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRVLEPMK

HMMSmart: SM00220
IPR002290
522-790 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRVLEPM

HMMSmart: SM00219
IPR020635
522-786 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSEVWRV

HMMPfam: PF00069
IPR017442
527-778 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDILSKLRHPNLVTLIGACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPD

PatternScan: PS00107
IPR017441
528-549 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYGSIYKGCLRHTQVAIK

Gene3D: G3DSA:1.10.510.10
582-782 no description

GACPEAWALIYEYLPNGSLEDRLNCRDNTPPLSWQARIRIAAELCSVLIFLHSNNPDSIVHGDLKPSNILLDANFGSKLSDFGICRVISHDGNSSNSATMCCRTGPKGTFAYMDPEFLSSGELTVKSDVYSFGIILLRLLTGKPAIGITKEVQHALDQGNLNTLLDPLAGDWPFVQAKQLALMALRCCEMNRKSRPDLVSE

PatternScan: PS00108
IPR008271
640-652 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHGDLKPSNILL

superfamily: SSF57850
793-880 RING/U-box,NBS

SCGASSSSFRVGSEERGQIPPYFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEWLQQ

Gene3D: G3DSA:3.30.40.10
IPR013083
810-880 no description
Zinc finger, RING/FYVE/PHD-type

QIPPYFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEWLQQ

HMMPfam: PF04564
IPR003613
811-880 U-box
U box domain

IPPYFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEWLQQ

HMMSmart: SM00504
IPR003613
814-877 Modified RING finger domain
U box domain

YFICPIFQEIMQDPCVAADGFTYEAEALRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox