PRGDB00078673 (Vvi.7882)

From PRG Wiki
Jump to: navigation, search
Vvi.7882
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225464654 (XM_002276730)
Gene Class N
Domain Type NBS
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100245835 (LOC100245835), mRNA

DNA Sequence

GTCACCAACATATCCCTCAACACCTCTCTCTCTGAACCAAAACCTCTCTTCCTCCACCCATCTCCACCACCTCCTCCATGGAAGACCACTCTTCATTACCACCCCCACCACACAAAACTTATAGAATAACAGCCTCTTCAATCTCTTACACCAAACCAACCACCAATAACTACACCATTGTCCCCACCTTCCTCTTCCAACCCTGCACTACAACTCCACCAACCTACATTCTCCGGGACATCTGCCTGACTGCTTATCCATCTCAAGTTCTCGCTATTGTTGGCCCAAGTGGAGCAGGGAAGTCCACCCTTCTCGACATTTTAGCTGCTCGAACCTCGCCTACAAGTGGCTCTCTCCTTCTCAATTCTTCCCCTCTCAACCGTTCTTCATTCAGGAAGCTCTCAGCTTATGTACCTCAACATGATGCATGCTTACCCCAGCTTACTGTTTCTGAAACTTTTGCCTTCGCAGCCAGCCTCCTTGTTCCCAAATCTTCCAAAATTGCCATCATAGTAGCCTCTCTTCTCAGTGAGCTCAGGCTAACTCACCTAGCACATACCAGGCTCGCCCATGGGCTATCTGGCGGTGAGCGTCGACGAGTCTCTATAGGCCTCAGCCTTCTCCATGACCCTGCCGTGTTGCTTCTTGATGAGCCAACATCTGGGCTTGACAGCAATTCGGCTTTCAATGTGATGCAGACCCTGCAGTCGATTGCGCAATCACGCCACCGCACTGTGATCTTGTCCATTCATCAACCTAGTTTCAAGATCCTTTCCACCATTGATAAAGTCCTTTTGCTCTCAAAAGGAACTGTTATCCACCATGGAACTCTTTCTTCACTTGAAACGTTCTTACTCTCCCATGGCTTCACTGTTCCTTCGCAGCTCAATTCCCTTGAATACGCTATGGAAATACTGAGCCAACTCCATGAGCATAAACCCcttacaccaccatcacttcctccatcaccagaaattcctgaaATTTCTCCTTCTAATCATAGCGGATCAATGATCAGATATAGGAGCTCAAGACTCCATGAAGTACTCGCTTTGTACAACAGGTTTTGGAAGATCGTTTACAGAACCAGACAGCTTCTCCTCGTGAACGCATTGGAAGCTCTTGGTGTGGGCCTTGTTCTAGGAACCATTTACATCAACATTGGATTCGACAAGCAAGGAATGGAGAAGCGATTAGGCCTCTTTGCCTTCACTCTCACCTTCCTCCTCTCTTCAACAACCGAAACTCTCCCAATTTTCATCAATGAAAGGCCAATTCTACTCAGGGAAACTTCAAGTGGGGTGTACAGGCTCTCGTCATATCTCATCGCAAACACATTGGTTTTCTTGCCATACTTGCTGGCCATCGCCATCATTTACTCAGTCTCCGTATACTTCTTAGTGGGTCTCTGTGCTACATGGCAAGCTTTTGCCTACTTTGTTTTGGTGATATGGGTAATAGTCCTCATGGCAAATTCATTTGTTCTCTTCCTGAGTTCGGTAGCTCCAAACTACATCGCCGGAACATCACTAGTCACAATATTTCTGGGCGCTTTCTTTCTCTTCTCCGGCTACTTCATCTCAAAAGACAGCATGCCCAAGTACTGGCTGTTCATGCACTTCTTCTCCATGTACAAATATGCCTTGGATGCCTTCCTCATCAATGAGTACTCATGCCTTGTTTCAAGGTGTTTGTTATGGTACGAAGAGAACAAGACATGTATGGCGACTGGGCGTGATGTGCTGCAGAAGAAAGGGCTCCATGAGAGGCAGAGATGGACCAACATCTACATGTTGATTGGATTCTTTTTCTTCTATCGTGTGCTTTGCTTTCTGGTTTTGATCAGGAGGGTTCGAAGATCAAAGAATTGAAGCCATGGCTAAATCATGTGATTTCTATTTACTCATTGTCTTAAAGTTAAATGTAAGTTTCCATTTTCATTTTGGTGTCAAAACTCAAGCTCATGTGTTGCATTCTGAAGCTTCATTTGGTCTATCATATAATAAATTGAAAATAGCGTGAATAAAGCTAGTTTTGTTCA


Protein sequences

Name Description Sequence
Vvi.7882 translated coding region predicted by ESTScan from UniGene Vvi.7882

MEDHSSLPPPPHKTYRITASSISYTKPTTNNYTIVPTFLFQPCTTTPPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHGTLSSLETFLLSHGFTVPSQLNSLEYAMEILSQLHEHKPLTPPSLPPSPEIPEISPSNHSGSMIRYRSSRLHEVLALYNRFWKIVYRTRQLLLVNALEALGVGLVLGTIYINIGFDKQGMEKRLGLFAFTLTFLLSSTTETLPIFINERPILLRETSSGVYRLSSYLIANTLVFLPYLLAIAIIYSVSVYFLVGLCATWQAFAYFVLVIWVIVLMANSFVLFLSSVAPNYIAGTSLVTIFLGAFFLFSGYFISKDSMPKYWLFMHFFSMYKYALDAFLINEYSCLVSRCLLWYEENKTCMATGRDVLQKKGLHERQRWTNIYMLIGFFFFYRVLCFLVLIRRVRRSKN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
8-593 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

PPPPHKTYRITASSISYTKPTTNNYTIVPTFLFQPCTTTPPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHGTLSSLETFLLSHGFTVPSQLNSLEYAMEILSQLHEHKPLTPPSLPPSPEIPEISPSNHSGSMIRYRSSRLHEVLALYNRFWKIVYRTRQLLLVNALEALGVGLVLGTIYINIGFDKQGMEKRLGLFAFTLTFLLSSTTETLPIFINERPILLRETSSGVYRLSSYLIANTLVFLPYLLAIAIIYSVSVYFLVGLCATWQAFAYFVLVIWVIVLMANSFVLFLSSVAPNYIAGTSLVTIFLGAFFLFSGYFISKDSMPKYWLFMHFFSMYKYALDAFLINEYSCLVSRCLLWYEENKTCMATGRDVLQKKGLHERQRWTNIYMLIGFFFFYRVLCFLVLIRRVR

HMMPanther: PTHR19241:SF103
8-593 PTHR19241:SF103

PPPPHKTYRITASSISYTKPTTNNYTIVPTFLFQPCTTTPPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHGTLSSLETFLLSHGFTVPSQLNSLEYAMEILSQLHEHKPLTPPSLPPSPEIPEISPSNHSGSMIRYRSSRLHEVLALYNRFWKIVYRTRQLLLVNALEALGVGLVLGTIYINIGFDKQGMEKRLGLFAFTLTFLLSSTTETLPIFINERPILLRETSSGVYRLSSYLIANTLVFLPYLLAIAIIYSVSVYFLVGLCATWQAFAYFVLVIWVIVLMANSFVLFLSSVAPNYIAGTSLVTIFLGAFFLFSGYFISKDSMPKYWLFMHFFSMYKYALDAFLINEYSCLVSRCLLWYEENKTCMATGRDVLQKKGLHERQRWTNIYMLIGFFFFYRVLCFLVLIRRVR

ProfileScan: PS50893
IPR003439
29-268 ABC_TRANSPORTER_2
ABC transporter-like

TNNYTIVPTFLFQPCTTTPPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHGTLSSLETFLLSHGFTVPS

Gene3D: G3DSA:3.40.50.300
47-255 G3DSA:3.40.50.300

PPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHGTLSSL

superfamily: SSF52540
51-250 SSF52540

ILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHG

HMMSmart: SM00382
IPR003593
61-253 AAA,NBS
AAA+ ATPase domain

PSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTSGLDSNSAFNVMQTLQSIAQSRHRTVILSIHQPSFKILSTIDKVLLLSKGTVIHHGTLS

HMMPfam: PF00005
IPR003439
76-195 ABC_tran
ABC transporter-like

STLLDILAARTSPTSGSLLLNSSPLNRSSFRKLSAYVPQHDACLPQLTVSETFAFAASLLVPKSSKIAIIVASLLSELRLTHLAHTRLAHGLSGGERRRVSIGLSLLHDPAVLLLDEPTS

PatternScan: PS00211
IPR017871
167-181 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGERRRVSIGLSL

HMMPfam: PF01061
IPR013525
323-531 ABC2_membrane
ABC-2 type transporter

VLALYNRFWKIVYRTRQLLLVNALEALGVGLVLGTIYINIGFDKQGMEKRLGLFAFTLTFLLSSTTETLPIFINERPILLRETSSGVYRLSSYLIANTLVFLPYLLAIAIIYSVSVYFLVGLCATWQAFAYFVLVIWVIVLMANSFVLFLSSVAPNYIAGTSLVTIFLGAFFLFSGYFISKDSMPKYWLFMHFFSMYKYALDAFLINEY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox