PRGDB00078681 (Vvi.8244)

From PRG Wiki
Jump to: navigation, search
Vvi.8244
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225459988 (XM_002268055)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100255036 (LOC100255036), mRNA

DNA Sequence

CTTTCCGTTCTTAGCCTCCTTGTAATTTGCCAGATCCAGTCCAGAAATGGCTTCTAGTAGCACCTTAAAAGCGTCGTCTTCCACTTCTAATTGTGATGGTTATAATTATCATGTGTTCTTGAGTTTTAGAGGTGAAGACACCCGCCAGACTTTCACTGGTCATCTTTATGCTAATTTGGTTGCACGTGGAATTCACACCTTCAGAGATGATGAAGAACTTGAGAAAGGAGGAGATATCGCATCAGATCTCTCGAGAGCTATCGAAGAATCAAAGATTTTTATTATTATTTTCTCGAAACACTATGCTGACTCCAAGTGGTGTTTGAATGAACTGGTAAAGATCATCGATTGTATGACAGAAAAGAAATCAGTGGTTTTGCCGGTTTTCTACCATGTGGAGCCAACAGATGTACGAAATCAAGGAGGAAGTTTTAAAGATGCATTTTTGGAGCatgcaaaagatgcagatcaagagaagaagaagaaaatagaaacgtggaagaaTGCCTTGAAGATAGCAGCCAACCTGTCTGGATTTCATCTGCAGAATCAATCTGAGGCAGAGTTTATTCAAAGGATTTATGAAGATATCGCTATAAGATTGAATCGTACGCCTTTAGATATGGGCTACAACATAGTTGGAATGGACTTTCATTTGACGCAATTAAAATCACTTATAAAAGTTGAATTGGATGAGGTTCTCATGGTTGGTATCTATGGGATTGGTGGAATTGGCAAAACTACCATCTCTAAGGCTATTTATAATGATATCTCGTCTCAATTTGATGGTTGTAGCTTTCTTGGAAATGTTGGGGGGAAATGTGAAGATGGTCTACTTAAATTACAAAAGACACTTCTTCAAGATATCGTCAAGTGTAAAGTGCCAAAATTCAACAATATTAGCCAAGGAATCAATGTGATAAAGGAAAGGCTTCGATCGAAAAGAGTCCTTATTGTTCTTGATGATGTGGACAACTACATGCAATTAGAAAACTTGGCTGGAAAACATGGTTGGTATGGTGCAAAAAGTATAATCATCATAACAACTAAAGATAAACATTTGTTAGATCAACATGAAGTAAAAGCACTTTATGAGGTGCAAAAGTTGAATCATGAAAAATCTGTTGAACTTTTTAATTGGTGGGCCTTCAAGCAAAATACTCCCAAAACTGGATTTGAAAGCCTTTCAAATAGTGTAGTGGAGTATACTCATGGTCTTCCAGTAGCACTTAAAGTTTTGGGTGGCTTTCTCTATGAGAAGTCAATAAATGAATGGGAAAGTGAATTGCATAAAGTaaaaaaaaTACCTGACGAGATAGTTCAAAATGTGCTTAAAGTAAGTTATGATAAATTGGATCATACATGTCAAGAGATATTCTTGGATATTGCATGTTTTTTCAGAGGAAAAGACAAAGATTTTGTTTCAAGAATATTAGGAAGTTATGCAATGATGGGAATAAAAGTTTTGAATGATAAATGTCTTCTTACTATTTCAGAAAACAAGTTAGATATGCATGATTTAGTACAACAAATGGGCCAAGAAATTGTTCGTCAAGAATGTCTCAAAGAGCCTGGAAACAGGAGTAGACTCTGGGATTGTAATGATGTTGATAGTGTGTTAACAAGAAATACGGGGACTCAAGCAATTGAAGGACTATTTGTACAAGGTTCTCTAGCAAGCCAGATATCTACAAATTCTTTCACAAAACTGAATAGACTTAGATTGCTCAAAGTCTATTATCCACATATGTGGAAGAAAGATTTTAAGGCCCTCAAGAATCTTGATTTTCCTTATTTTGAGTTAAGATATTTCCATTTTAAGGGATACCCTTTAGAATCCTTGCCAACAAATTTTCATGCAAAGAATCTTGTTGAACTTAATTTAAAGCATAGCAGCATAAAACAACTTTGGCAAGGGAATGAGATTCTTGACAACTTGAAAGTCATCAACCTTAGTTACTCAGAGAAACTTGTTGAAATTTCAGACTTTTCAAGGGTGACAAATTTGGAGATCCTAATTCTAAAAGGTTGGTGTAGGAGCCTTGAGAGTCTTCCAAGAAACTTTCATAAGTTGGAACGTCTTCAAAGTCTCTCTTGTAAAGATTGTTTAAAGATGAAGAGTTTTCCCGCAATCAAAGGAAATATGAGTAAGCTAAGAGAGATTGATTTGACAGCTACAAGTATAAAAGAGCTTCCATCCTCAATTGCATATCTAAAGGCTCTTCAACACCTAGATTTGTCATGGTGCAAAAGCCTAAGGAGTCTTTCAGAGAGCATTTGCAATTTAAGCTCTCTTAAAACTCTCATCTTGGAGGGGTGTTCAAATTTAAAGGGGTTTCCAGAAATCAATGATGATATGGAAAATCTAAAAATGCTTGATTTGAGTCGTACAGGTATAAAAGAGCTTCCATCCTCAATTGGACATCTAAAGGCTCTTAAACACCTTAATTTGTTATCGTGCGGAAACCTTGCAAAACTTCCAGAGAGCATTTGCAATTTGAGGTCTCTTGAAACTCTGATTTTGGAGGGGTGTTCAAATTTAGAGGGCTTTCCAAAAATCAATGATGATATGGAAAATCTAAAAAGGCTTAATTTGAAGGAAACATGTATAGAAAAGCTTCCATCATCTATTGGACATCTAAAGGCTCTTAAACACCTAGATTTGTTTAGTTGCAAAAGCCTAAGGAGTCTTTCGGAGAGCATTTGCAATTTGAGCTCTCTTGAAACTCTCATCTTGGAGGGGTGTTCAAATTTAAAGGGCTTTCCAGAAATCAAAGATGATATGGAAAATCTAAAAAGGCTTGATTTGAGTTTTACAGGTATAGAAGAGCTTCCATCCTCAATTGGACGTCTAAAGGCTCTTCAACACCTAGATTTGTCTAGTTGCAAAAGCCTAAGGTGTCTTTCTGAGAGCATTTGCAATTTGAGCTCTCTTGAAACTCTCATCTTGAAGGGGTGTTCAAATTTAAAGGGCTTTCTAGAAATCATAGATTATATGAAAAATCTAGAACATCTTGATTTGAGTTTTACAGGTATAGAAGAGCTTCCATCCTCAATTGGACGTTTAAAGGCTCTTCAGCACCTAGATTTGTCTAGTTGCAAAAGCCTAAGGAGTCTTTCAGAGAGTATTTGCAATTTGAGCTCTCTTGAAACTCTCATTTTGGAGGGGTGTTCAAATTTAAAGGGCTTTCCAGAAATCAAAGATGACATGGAAAATCTAAAAAGGCTGGATTTGAGTTTTATAGGTATAAAAGAGCTTTCATCCTCAATTGGACGTCTAAAGGCTCTTAAACACTTGAATTTGAAATGTTGTACAAAGCTTGTGAGCCTTCCAGATATCATTTGCAATTTAAGCTCTCTTGAAACTCTCATCTTGGAGGGGTGTTCAAATTTAAAGGGCTTTCCAAAAATCAAAGATGATATGGAAAATCTAAAAAGGCTTGATTTGAGTTTTACAAGTATAGAAGAGTTTCCATCCTCAATTGGACGTCTAAAGGCTCTTCAACACCTAGATTTGTCATATTGCAAAAGCCTAAGGTGTCTTTCAGAGAGCATTTGCAATTTGAGCTCTCTTGAAACTCTCATCTTGGAGGGGTGTTCAAATTTAAAGGGTTTTCCAGAAATCAAAGATGATATGGAAAATCTAAAAATGCTTGATTTAAGTTTTACAGGTATAGAAGAGCTTCCATCCTCAATTGGACGTCTAAAGGCTCTTAAACACTTGAATTTGAAATGTTGTGCAGAGCTTGTGAGTCTTCCAGATAGTATTTGCAGAGCTCTTAAAAAACTTGATGTCCAAAAATGCCCTAAACTGGAGAGAGTGGAGGTGAACTTAGTGGGATCTTTGGATCTAACTTGTTGCATTCTAAAGCAAAGAGTAATCTGGTGGAGCAATAATCTACTACAAAATGAAGTGGAAGGAGAGGTCCTTAACCATTATGTTTTGTCCCTGTCATCACTGGTAGAATCATGTTCAAGAGACTACAGAGGTTTCCACCTATCTGCACTAGAAGTATTATCCGTAGGTAACTTCAGTCCAATTCAAAGAAGAATCCTCAGTGATATTTTCCGCCAATCTTCATTGAAAAGTGTATGTCTTCGTAACTGCAATCTAATGGAAGAAGGAGTCCCTAGTGATATTTGGAACCTATCTTCACTGGTAAATTTATCTCTAAGTAACTGCAGTCTAACGGAAGGAGAGATCCTCAATCATATTTGCCACGTTTCATCATTGCAAAACTTATCTCTGGATGGGAACCATTTTAGTAGCATACCTGCCAACATCATTCAACTTTCTAAACTGAGAACCCTCGGCTTGTATCACTGCCAGAAGCTTCTACAAATTCCAGAGCTTCCACCGAGTTTACGAGCTCTTGATGTCCACGACTGCCCATGCCTGGAAACTTTATCAAGTCTCTCAAGTTTACTTGGTTTTTCCTTGTTCAAGTGCTTCGAATCAACAATTGAGAAGTGTAGGTGGTCCTATTGGAGGAAGAAATTCGAAATTTTGACCTTATATTTAATGCCTGGAAATAATGGAATTCCAGAGTGGATAAGCCATAAGAAAAAGGGATCTAAAATAGGAGTAGAACTTCCTGAGAATTGGTGGGAGGATAACAACTTTTTGGGATTTGCCTTATGCTCTGTTTTTGAATATGAAGATCCTTGGTGTCAATTGACCTTCCATAATTTTTACTTTGATTATCCGGATGGTTGCTTATCTAAATCCAAGTTCATGGATCTACTCATATTTAGCCGTAGCTTTCTACATTGCCGTAATTGTGGTGAATCAAATAGAGTCTTGGTGGCATTTTATCCAAAGGTTGCTATTGAGAATAAGCATTGGTCAAATGAATGGAGACATTTGAAGGCTTCATTTTATGGTGAAGAAGTGAAAGTGGAAGAGTGTGGGCTTCATCTTATATATAAAACCAACATCTTCAACAGAGATTCCAATGCCACCAACCATTGGCCTCGGTTATTGAGTGAAAATACAGATTTCAATGTTAAGGAGAAGTCTTGA


Protein sequences

Name Description Sequence
Vvi.8244 translated coding region predicted by ESTScan from UniGene Vvi.8244

MASSSTLKASSSTSNCDGYNYHVFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKIAANLSGFHLQNQSEAEFIQRIYEDIAIRLNRTPLDMGYNIVGMDFHLTQLKSLIKVELDEVLMVGIYGIGGIGKTTISKAIYNDISSQFDGCSFLGNVGGKCEDGLLKLQKTLLQDIVKCKVPKFNNISQGINVIKERLRSKRVLIVLDDVDNYMQLENLAGKHGWYGAKSIIIITTKDKHLLDQHEVKALYEVQKLNHEKSVELFNWWAFKQNTPKTGFESLSNSVVEYTHGLPVALKVLGGFLYEKSINEWESELHKVKKIPDEIVQNVLKVSYDKLDHTCQEIFLDIACFFRGKDKDFVSRILGSYAMMGIKVLNDKCLLTISENKLDMHDLVQQMGQEIVRQECLKEPGNRSRLWDCNDVDSVLTRNTGTQAIEGLFVQGSLASQISTNSFTKLNRLRLLKVYYPHMWKKDFKALKNLDFPYFELRYFHFKGYPLESLPTNFHAKNLVELNLKHSSIKQLWQGNEILDNLKVINLSYSEKLVEISDFSRVTNLEILILKGWCRSLESLPRNFHKLERLQSLSCKDCLKMKSFPAIKGNMSKLREIDLTATSIKELPSSIAYLKALQHLDLSWCKSLRSLSESICNLSSLKTLILEGCSNLKGFPEINDDMENLKMLDLSRTGIKELPSSIGHLKALKHLNLLSCGNLAKLPESICNLRSLETLILEGCSNLEGFPKINDDMENLKRLNLKETCIEKLPSSIGHLKALKHLDLFSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRCLSESICNLSSLETLILKGCSNLKGFLEIIDYMKNLEHLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFIGIKELSSSIGRLKALKHLNLKCCTKLVSLPDIICNLSSLETLILEGCSNLKGFPKIKDDMENLKRLDLSFTSIEEFPSSIGRLKALQHLDLSYCKSLRCLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKMLDLSFTGIEELPSSIGRLKALKHLNLKCCAELVSLPDSICRALKKLDVQKCPKLERVEVNLVGSLDLTCCILKQRVIWWSNNLLQNEVEGEVLNHYVLSLSSLVESCSRDYRGFHLSALEVLSVGNFSPIQRRILSDIFRQSSLKSVCLRNCNLMEEGVPSDIWNLSSLVNLSLSNCSLTEGEILNHICHVSSLQNLSLDGNHFSSIPANIIQLSKLRTLGLYHCQKLLQIPELPPSLRALDVHDCPCLETLSSLSSLLGFSLFKCFESTIEKCRWSYWRKKFEILTLYLMPGNNGIPEWISHKKKGSKIGVELPENWWEDNNFLGFALCSVFEYEDPWCQLTFHNFYFDYPDGCLSKSKFMDLLIFSRSFLHCRNCGESNRVLVAFYPKVAIENKHWSNEWRHLKASFYGEEVKVEECGLHLIYKTNIFNRDSNATNHWPRLLSENTDFNVKEKS

Domains

Domain Start-End Description Sequence

Seg: seg
2-14 seg

ASSSTLKASSSTS

superfamily: SSF52200
IPR000157
9-164 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ASSSTSNCDGYNYHVFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKIAANLSGF

Gene3D: G3DSA:3.40.50.10140
17-157 no description

DGYNYHVFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKI

ProfileScan: PS50104
IPR000157
19-161 TIR
Toll-Interleukin receptor

YNYHVFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKIAANL

HMMSmart: SM00255
IPR000157
20-161 Toll
Toll/interleukin-1 receptor homology (TIR) domain

NYHVFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKIAANL

HMMPfam: PF01582
IPR000157
23-156 TIR
Toll-Interleukin receptor

VFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALK

HMMPanther: PTHR11017:SF20
46-1455 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKIAANLSGFHLQNQSEAEFIQRIYEDIAIRLNRTPLDMGYNIVGMDFHLTQLKSLIKVELDEVLMVGIYGIGGIGKTTISKAIYNDISSQFDGCSFLGNVGGKCEDGLLKLQKTLLQDIVKCKVPKFNNISQGINVIKERLRSKRVLIVLDDVDNYMQLENLAGKHGWYGAKSIIIITTKDKHLLDQHEVKALYEVQKLNHEKSVELFNWWAFKQNTPKTGFESLSNSVVEYTHGLPVALKVLGGFLYEKSINEWESELHKVKKIPDEIVQNVLKVSYDKLDHTCQEIFLDIACFFRGKDKDFVSRILGSYAMMGIKVLNDKCLLTISENKLDMHDLVQQMGQEIVRQECLKEPGNRSRLWDCNDVDSVLTRNTGTQAIEGLFVQGSLASQISTNSFTKLNRLRLLKVYYPHMWKKDFKALKNLDFPYFELRYFHFKGYPLESLPTNFHAKNLVELNLKHSSIKQLWQGNEILDNLKVINLSYSEKLVEISDFSRVTNLEILILKGWCRSLESLPRNFHKLERLQSLSCKDCLKMKSFPAIKGNMSKLREIDLTATSIKELPSSIAYLKALQHLDLSWCKSLRSLSESICNLSSLKTLILEGCSNLKGFPEINDDMENLKMLDLSRTGIKELPSSIGHLKALKHLNLLSCGNLAKLPESICNLRSLETLILEGCSNLEGFPKINDDMENLKRLNLKETCIEKLPSSIGHLKALKHLDLFSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRCLSESICNLSSLETLILKGCSNLKGFLEIIDYMKNLEHLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFIGIKELSSSIGRLKALKHLNLKCCTKLVSLPDIICNLSSLETLILEGCSNLKGFPKIKDDMENLKRLDLSFTSIEEFPSSIGRLKALQHLDLSYCKSLRCLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKMLDLSFTGIEELPSSIGRLKALKHLNLKCCAELVSLPDSICRALKKLDVQKCPKLERVEVNLVGSLDLTCCILKQRVIWWSNNLLQNEVEGEVLNHYVLSLSSLVESCSRDYRGFHLSALEVLSVGNFSPIQRRILSDIFRQSSLKSVCLRNCNLMEEGVPSDIWNLSSLVNLSLSNCSLTEGEILNHICHVSSLQNLSLDGNHFSSIPANIIQLSKLRTLGLYHCQKLLQIPELPPSLRALDVHDCPCLETLS

HMMPanther: PTHR11017
46-1455 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ARGIHTFRDDEELEKGGDIASDLSRAIEESKIFIIIFSKHYADSKWCLNELVKIIDCMTEKKSVVLPVFYHVEPTDVRNQGGSFKDAFLEHAKDADQEKKKKIETWKNALKIAANLSGFHLQNQSEAEFIQRIYEDIAIRLNRTPLDMGYNIVGMDFHLTQLKSLIKVELDEVLMVGIYGIGGIGKTTISKAIYNDISSQFDGCSFLGNVGGKCEDGLLKLQKTLLQDIVKCKVPKFNNISQGINVIKERLRSKRVLIVLDDVDNYMQLENLAGKHGWYGAKSIIIITTKDKHLLDQHEVKALYEVQKLNHEKSVELFNWWAFKQNTPKTGFESLSNSVVEYTHGLPVALKVLGGFLYEKSINEWESELHKVKKIPDEIVQNVLKVSYDKLDHTCQEIFLDIACFFRGKDKDFVSRILGSYAMMGIKVLNDKCLLTISENKLDMHDLVQQMGQEIVRQECLKEPGNRSRLWDCNDVDSVLTRNTGTQAIEGLFVQGSLASQISTNSFTKLNRLRLLKVYYPHMWKKDFKALKNLDFPYFELRYFHFKGYPLESLPTNFHAKNLVELNLKHSSIKQLWQGNEILDNLKVINLSYSEKLVEISDFSRVTNLEILILKGWCRSLESLPRNFHKLERLQSLSCKDCLKMKSFPAIKGNMSKLREIDLTATSIKELPSSIAYLKALQHLDLSWCKSLRSLSESICNLSSLKTLILEGCSNLKGFPEINDDMENLKMLDLSRTGIKELPSSIGHLKALKHLNLLSCGNLAKLPESICNLRSLETLILEGCSNLEGFPKINDDMENLKRLNLKETCIEKLPSSIGHLKALKHLDLFSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRCLSESICNLSSLETLILKGCSNLKGFLEIIDYMKNLEHLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFIGIKELSSSIGRLKALKHLNLKCCTKLVSLPDIICNLSSLETLILEGCSNLKGFPKIKDDMENLKRLDLSFTSIEEFPSSIGRLKALQHLDLSYCKSLRCLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKMLDLSFTGIEELPSSIGRLKALKHLNLKCCAELVSLPDSICRALKKLDVQKCPKLERVEVNLVGSLDLTCCILKQRVIWWSNNLLQNEVEGEVLNHYVLSLSSLVESCSRDYRGFHLSALEVLSVGNFSPIQRRILSDIFRQSSLKSVCLRNCNLMEEGVPSDIWNLSSLVNLSLSNCSLTEGEILNHICHVSSLQNLSLDGNHFSSIPANIIQLSKLRTLGLYHCQKLLQIPELPPSLRALDVHDCPCLETLS

Seg: seg
72-84 seg

IEESKIFIIIFSK

superfamily: SSF52540
183-430 P-loop containing nucleoside triphosphate hydrolases

AIRLNRTPLDMGYNIVGMDFHLTQLKSLIKVELDEVLMVGIYGIGGIGKTTISKAIYNDISSQFDGCSFLGNVGGKCEDGLLKLQKTLLQDIVKCKVPKFNNISQGINVIKERLRSKRVLIVLDDVDNYMQLENLAGKHGWYGAKSIIIITTKDKHLLDQHEVKALYEVQKLNHEKSVELFNWWAFKQNTPKTGFESLSNSVVEYTHGLPVALKVLGGFLYEKSINEWESELHKVKKIPDEIVQNVLK

Gene3D: G3DSA:3.40.50.300
196-342 no description

NIVGMDFHLTQLKSLIKVELDEVLMVGIYGIGGIGKTTISKAIYNDISSQFDGCSFLGNVGGKCEDGLLKLQKTLLQDIVKCKVPKFNNISQGINVIKERLRSKRVLIVLDDVDNYMQLENLAGKHGWYGAKSIIIITTKDKHLLDQ

HMMPfam: PF00931
IPR002182
208-455 NB-ARC,NBS
NB-ARC

KSLIKVELDEVLMVGIYGIGGIGKTTISKAIYNDISSQFDGCSFLGNVGGKCEDGLLKLQKTLLQDIVKCKVPKFNNISQGINVIKERLRSKRVLIVLDDVDNYMQLENLAGKHGWYGAKSIIIITTKDKHLLDQHEVKALYEVQKLNHEKSVELFNWWAFKQNTPKTGFESLSNSVVEYTHGLPVALKVLGGFLYEKSINEWESELHKVKKIPDEIVQNVLKVSYDKLDHTCQEIFLDIACFFRGKD

FPrintScan: PR00364
IPR000767
220-235 DISEASERSIST
Disease resistance protein

MVGIYGIGGIGKTTIS

Seg: seg
222-230 seg

GIYGIGGIG

FPrintScan: PR00364
IPR000767
295-309 DISEASERSIST
Disease resistance protein

RLRSKRVLIVLDDVD

FPrintScan: PR00364
IPR000767
388-402 DISEASERSIST
Disease resistance protein

THGLPVALKVLGGFL

superfamily: SSF52058
488-900 L domain-like,LRR

DMHDLVQQMGQEIVRQECLKEPGNRSRLWDCNDVDSVLTRNTGTQAIEGLFVQGSLASQISTNSFTKLNRLRLLKVYYPHMWKKDFKALKNLDFPYFELRYFHFKGYPLESLPTNFHAKNLVELNLKHSSIKQLWQGNEILDNLKVINLSYSEKLVEISDFSRVTNLEILILKGWCRSLESLPRNFHKLERLQSLSCKDCLKMKSFPAIKGNMSKLREIDLTATSIKELPSSIAYLKALQHLDLSWCKSLRSLSESICNLSSLKTLILEGCSNLKGFPEINDDMENLKMLDLSRTGIKELPSSIGHLKALKHLNLLSCGNLAKLPESICNLRSLETLILEGCSNLEGFPKINDDMENLKRLNLKETCIEKLPSSIGHLKALKHLDLFSCKSLRSLSESICNLSSLETLILEGC

Gene3D: G3DSA:3.80.10.10
531-816 no description

TQAIEGLFVQGSLASQISTNSFTKLNRLRLLKVYYPHMWKKDFKALKNLDFPYFELRYFHFKGYPLESLPTNFHAKNLVELNLKHSSIKQLWQGNEILDNLKVINLSYSEKLVEISDFSRVTNLEILILKGWCRSLESLPRNFHKLERLQSLSCKDCLKMKSFPAIKGNMSKLREIDLTATSIKELPSSIAYLKALQHLDLSWCKSLRSLSESICNLSSLKTLILEGCSNLKGFPEINDDMENLKMLDLSRTGIKELPSSIGHLKALKHLNLLSCGNLAKLPESIC

ProfileScan: PS51450
IPR001611
607-628 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVELNLKHSSIKQLWQGNEIL

HMMPfam: PF07725
IPR011713
607-625 LRR_3
Leucine-rich repeat 3

NLVELNLKHSSIKQLWQGN

ProfileScan: PS51450
IPR001611
630-652 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKVINLSYSEKLVEISDFSRVT

HMMSmart: SM00369
IPR003591
700-722 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MSKLREIDLTATSIKELPSSIAY

HMMPfam: PF13855
701-758 LRR_8,Leucine rich repeat

SKLREIDLTATSIKELPSSIAYLKALQHLDLSWCKSLRSLSESICNLSSLKTLILEGC

ProfileScan: PS51450
IPR001611
702-723 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLREIDLTATSIKELPSSIAYL

HMMSmart: SM00367
IPR006553
723-750 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

LKALQHLDLSWCKSLRSLSESICNLSSL

HMMSmart: SM00369
IPR003591
723-747 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKALQHLDLSWCKSLRSLSESICNL

ProfileScan: PS51450
IPR001611
725-747 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQHLDLSWCKSLRSLSESICNL

HMMSmart: SM00369
IPR003591
771-794 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLKMLDLSRTGIKELPSSIGHL

HMMPfam: PF12799
772-803 LRR_4,Leucine Rich repeats (2 copies)

ENLKMLDLSRTGIKELPSSIGHLKALKHLNLL

ProfileScan: PS51450
IPR001611
773-794 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKMLDLSRTGIKELPSSIGHL

HMMSmart: SM00367
IPR006553
794-821 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

LKALKHLNLLSCGNLAKLPESICNLRSL

ProfileScan: PS51450
IPR001611
796-818 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKHLNLLSCGNLAKLPESICNL

Gene3D: G3DSA:3.80.10.10
817-1033 no description

NLRSLETLILEGCSNLEGFPKINDDMENLKRLNLKETCIEKLPSSIGHLKALKHLDLFSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRCLSESICNLSSLETLILKGCSNLKGFLEIIDYMKNLEHLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRSLSESICNLSS

HMMSmart: SM00369
IPR003591
842-865 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLKRLNLKETCIEKLPSSIGHL

ProfileScan: PS51450
IPR001611
844-865 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLNLKETCIEKLPSSIGHL

HMMSmart: SM00367
IPR006553
865-892 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

LKALKHLDLFSCKSLRSLSESICNLSSL

ProfileScan: PS51450
IPR001611
878-899 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRSLSESICNLSSLETLILEG

superfamily: SSF52058
902-1254 L domain-like,LRR

NLKGFPEIKDDMENLKRLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRCLSESICNLSSLETLILKGCSNLKGFLEIIDYMKNLEHLDLSFTGIEELPSSIGRLKALQHLDLSSCKSLRSLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKRLDLSFIGIKELSSSIGRLKALKHLNLKCCTKLVSLPDIICNLSSLETLILEGCSNLKGFPKIKDDMENLKRLDLSFTSIEEFPSSIGRLKALQHLDLSYCKSLRCLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKMLDLSFTGIEELPSSIGRLKALKHLNLKCCAELVSLPDSICRALKKLDVQKCP

HMMSmart: SM00369
IPR003591
913-936 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLKRLDLSFTGIEELPSSIGRL

HMMPfam: PF12799
914-948 LRR_4,Leucine Rich repeats (2 copies)

ENLKRLDLSFTGIEELPSSIGRLKALQHLDLSSCK

ProfileScan: PS51450
IPR001611
915-936 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLDLSFTGIEELPSSIGRL

FPrintScan: PR00364
IPR000767
934-950 DISEASERSIST
Disease resistance protein

GRLKALQHLDLSSCKSL

HMMSmart: SM00367
IPR006553
936-963 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

LKALQHLDLSSCKSLRCLSESICNLSSL

ProfileScan: PS51450
IPR001611
949-970 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRCLSESICNLSSLETLILKG

HMMSmart: SM00369
IPR003591
984-1007 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKNLEHLDLSFTGIEELPSSIGRL

HMMPfam: PF12799
985-1019 LRR_4,Leucine Rich repeats (2 copies)

KNLEHLDLSFTGIEELPSSIGRLKALQHLDLSSCK

ProfileScan: PS51450
IPR001611
986-1007 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEHLDLSFTGIEELPSSIGRL

HMMSmart: SM00367
IPR006553
1007-1034 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

LKALQHLDLSSCKSLRSLSESICNLSSL

ProfileScan: PS51450
IPR001611
1009-1031 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQHLDLSSCKSLRSLSESICNL

Seg: seg
1013-1027 seg

LDLSSCKSLRSLSES

Gene3D: G3DSA:3.80.10.10
1034-1260 no description

LETLILEGCSNLKGFPEIKDDMENLKRLDLSFIGIKELSSSIGRLKALKHLNLKCCTKLVSLPDIICNLSSLETLILEGCSNLKGFPKIKDDMENLKRLDLSFTSIEEFPSSIGRLKALQHLDLSYCKSLRCLSESICNLSSLETLILEGCSNLKGFPEIKDDMENLKMLDLSFTGIEELPSSIGRLKALKHLNLKCCAELVSLPDSICRALKKLDVQKCPKLERVE

HMMSmart: SM00369
IPR003591
1055-1078 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLKRLDLSFIGIKELSSSIGRL

ProfileScan: PS51450
IPR001611
1057-1078 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLDLSFIGIKELSSSIGRL

ProfileScan: PS51450
IPR001611
1080-1102 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKHLNLKCCTKLVSLPDIICNL

HMMSmart: SM00369
IPR003591
1126-1149 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLKRLDLSFTSIEEFPSSIGRL

HMMPfam: PF12799
1127-1161 LRR_4,Leucine Rich repeats (2 copies)

ENLKRLDLSFTSIEEFPSSIGRLKALQHLDLSYCK

ProfileScan: PS51450
IPR001611
1128-1149 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLDLSFTSIEEFPSSIGRL

HMMSmart: SM00367
IPR006553
1149-1176 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

LKALQHLDLSYCKSLRCLSESICNLSSL

ProfileScan: PS51450
IPR001611
1162-1183 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRCLSESICNLSSLETLILEG

HMMSmart: SM00369
IPR003591
1197-1220 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLKMLDLSFTGIEELPSSIGRL

HMMPfam: PF12799
1198-1229 LRR_4,Leucine Rich repeats (2 copies)

ENLKMLDLSFTGIEELPSSIGRLKALKHLNLK

ProfileScan: PS51450
IPR001611
1199-1220 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKMLDLSFTGIEELPSSIGRL

HMMSmart: SM00367
IPR006553
1242-1267 Leucine-rich repeat - CC (cysteine-containin
Leucine-rich repeat, cysteine-containing subtype

CRALKKLDVQKCPKLERVEVNLVGSL

Seg: seg
1300-1305 seg

LSLSSL

Gene3D: G3DSA:3.80.10.10
1317-1460 no description

HLSALEVLSVGNFSPIQRRILSDIFRQSSLKSVCLRNCNLMEEGVPSDIWNLSSLVNLSLSNCSLTEGEILNHICHVSSLQNLSLDGNHFSSIPANIIQLSKLRTLGLYHCQKLLQIPELPPSLRALDVHDCPCLETLSSLSSL

superfamily: SSF52047
1317-1468 RNI-like,LRR

HLSALEVLSVGNFSPIQRRILSDIFRQSSLKSVCLRNCNLMEEGVPSDIWNLSSLVNLSLSNCSLTEGEILNHICHVSSLQNLSLDGNHFSSIPANIIQLSKLRTLGLYHCQKLLQIPELPPSLRALDVHDCPCLETLSSLSSLLGFSLFKC

Seg: seg
1367-1381 seg

NLSSLVNLSLSNCSL

ProfileScan: PS51450
IPR001611
1370-1391 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVNLSLSNCSLTEGEILNHIC

HMMPfam: PF13504
1370-1383 LRR_7,Leucine rich repeat

SLVNLSLSNCSLTE

HMMSmart: SM00369
IPR003591
1393-1416 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VSSLQNLSLDGNHFSSIPANIIQL

ProfileScan: PS51450
IPR001611
1395-1417 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQNLSLDGNHFSSIPANIIQLS

HMMPfam: PF00560
IPR001611
1395-1414 LRR_1
Leucine-rich repeat

SLQNLSLDGNHFSSIPANII

ProfileScan: PS51450
IPR001611
1418-1438 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRTLGLYHCQKLLQIPELPP

ProfileScan: PS51450
IPR001611
1439-1461 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRALDVHDCPCLETLSSLSSLL

Seg: seg
1454-1466 seg

LSSLSSLLGFSLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox