PRGDB00078691 (Vvi.8457)

From PRG Wiki
Jump to: navigation, search
Vvi.8457
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225442482 (XM_002278254)
Gene Class N
Domain Type NBS
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100253259 (LOC100253259), mRNA

DNA Sequence

ATGGACACTATCAATGGTGGTGCAGAAAGCCAGCCTCCCACTTCTTTTCCGGAGAAAGATGAGGAAGAGGCTGTGAGATGGGGTGCTTTAGAGAAGCTGCCAACATATGATAGACTAAGAACCAGTATACTGAAGAGTGTGGTGGAGGGGGAGAGTGAAGAGAAAAGTGGTAGGGTGGTCTACAAGGAGGTTGATGTTGGAAAGCTTGATGAGAGTGACAGAGAGAACTTCATTCACAGGAATTTTAAGGTTGCTGATGATGATAATGAGAAGTTCCTGCAGAGACTCAGAAATCGTTTTGATAGGGTTGGTGTGGAACTCCCAAAAGTTGAAGTTAGAATCGAGAGGCTAAGGGTGGAAGTTGACTGCTACGTTGGAACAAGAGCTCTTCCAACTTTAACAAACACTGCTCGTAACATGCTTGAATCAGCTCTTGGTCTGTTTGGAATCATTCTGGCCAAGAGAACCAACCACACTATTCTCAGAGACATCTCTGCAATCATAAAGCCATCCAGGATGACTCTTTTGTTAGGGCCCCCATCGTCCGGCAAAACAACCCTTCTGTTGGCGCTGGCCGGAATGTTGGATCAAAGCTTAAAGGTCAAAGGAGAAATCACTTACAATGGGTGCAATTTCAATGAATTCGTGCCACAAAAGACGTCTGCATACATTAGCCAAAATAATGTTCATCTTGGAGAGCTTACCGTTAAAGAAACTTTAGATTATTCAGCAAGATTTCAGGGCATTGGTTCTCGACGAGAACTCTTGACTGAGCTTGTGAAGAAAGAAGAGGAGATTGGAATATTTACCGACACAAACGTGGATCTTTTCTTGAAGGCATGTGCAATGGAAGGAGATGAAAGCAGTATCATTACGGACTACATTCTCAAGATATTAGGGCTGGATGTATGTAAGGACACGCTGGTTGGAAATGAGATGATGCGGGGAATTTCTGGTGGACAAAAGAAGAGAGTAACATCAGGGGAGATGATAGTGGGACCGGCGAAGTTTCTGTTGATGGACGAGATATCGACGGGCCTGGACAGCTCCACGACTCTGCAGATAGTGAGATGCATGCAGCAGATCGCACACTTCACTCACTCTACTGTATTTATGTCTCTGCTACAGCCTGATCCTGAGACGTTCAATCTCTTTGATGATGTTATTCTCCTATCGGAGGGTCAGATTGTGTACCAGGGCCCAAGGGAGCACGTACTCCACTTCTTCCAGAATTGTGGGTTCCAGTGCCCTGAGAGAAAGGGCACTGCGGACTTCTTGCAAGAGGTTACCTCAAAGAAGGATCAAGAGCAGTACTGGGCAGATTCCACCGAGCCCTACCGATACGTATCAGTCACCGAATTCGCCACCCTGTTCAAGGCCTTCCATGTCGGGCTGCAGCTGGAGGACGACCTCAAGCTCCCCTATGACAAGAGCCAATGTCACAAATCAGCCCTTGTCTTCAAAAAATGCACTATCCCAAAAATGCAGCTTCTCAAAACATCCTTTGATAAGGAGTGGCTTCTGCTAAAGAGAACCTCATTTGTGTATATCTTCAAGGGCATTCAGCTCATCATCGTTGCCTTCATCGTTTCAACAGTCTTCCTCAGAACCACACTTGATGTCTCATACGATGATGGTCCACTCTATATAGGTGCAATCATATTTTCCATCATCATCAACATGTTCAATGGTTTTGCCGAGCTTTCCCTCACCATCGCGAGGCTCCCCGTGTTTTACAAGCATAGAGACCTTCTTTTCTACCCTGCATGGGCTTTCACCCTCCCGAGTTGTCTTCTCCGAATCCCCATATCGGTCGTGGAGTCTGTAATTTGGACAGTCATAGTGTATTACACCATAGGATATGCTCCTGAGACTAGCAGGTTTTTCAAGCAGATGCTGATGATATTTCTGATTCAGCAAATGGCTTCTGGGGTATTTAGACTCATAGGGGGAGTGTGCAGGAGTATGATTGTTGCCCACACTGGTGGAGCGCTTGTTCTTTTCATTGTTTTCTTGCTTAGCGGTTTTATCCTTCCTCTAGATGAAATTCCTAAATGGTGGAACTGGGGGCACTGGATTTCACCCCTATCTTATGGTTTCAAGGCCATGACTATCAATGAAATGCTTTCTCCAAGGTGGATGAACAAACTGGGGCCGGACAATTCTACTCTGCTGGGTGTAGCAGTTCTAGACAATGTGGATGTGGAATCAGAGAGCTACTGGTACTGGATTGGAGCTGCTTGTCTTTTGGGGTTCACCATTCTCTTCAACATTCTCTTCACCTTCTCGCTTATGTACCTGAATCCTCTTGGGAAGCCACAGGCTATAATATCTGAAGAAGCTGCAAAAGAACAGGAACCCAACCAGGGAGACCAAACAACAATTCCTAAGAAAACGGGCATTAAGAGAGGAATGATTCTTCCATTTTTACCTCTATCCATGTCCTTTGACAATGTAAATTACTATGTGGACATGCCCAAGGAAATGAAGAGCCAAGGAGTGACAGAGCACAGGCTGCAGTTGCTTCGGGAAGTGACAGGAACATTCAGGCCAGGAGTCCTTACTGCACTGATGGGAGTTAGTGGAGCTGGAAAGACAACGCTGATGGATGTTCTAGCAGGAAGAAAAACCGGGGGTTACATTGAAGGGGACATTAGAATATCTGGGTTCCCCAAGAAACAAGAAACTTTTGCAAGAATTTCCAGTTACTGTGAGCAGAATGATATCCACTCTCCCCAAGTCACTGTTATTGAATCTTTGATCTACTCAGCTTTCCTAAGGCTCCCTAAAGAAGTTCCTGACAAAGAAAAGATGATTTTTGTGAATGAAGTGATGGAGCTAGTCGAGCTCAGCAGCATAAAATATGCACTAGTGGGGCTTCCAGGAGTCACAGGTTTATCAACAGAACAGAGGAAGAGGCTGACAATAGCTGTGGAACTTGTTGCTAATCCTTCAATCATCTTTATGGATGAACCAACCTCTGGCCTTGATGCAAGGGCAGCAGCTATTGTGATGAGGACGGTGAGGAACACAGTGGACACTGGAAGAACTGTTGTCTGCACAATCCATCAGCCCAGTATCGATATCTTTGAAGCCTTTGATGAGCTGCTACTAATGAAGACAGGAGGAGAGCTTATCTACTCAGGACCATTGGGTCAGAATTCTCATAAGATTATCGAATATTTTGAGGCAATTCCCGGTGTCCTGAAAATCAAGGAAAAATACAATCCAGCGGCATGGATGCTGGAAGTGAGCTCAGCCTCAGCTGAAGTCCAACTTGGAATCAATTTTGCAGACTACTTAATAAAATCGCCCCAATATCAAGAGAACAAAGCCCTAGTAAAGGAGTTGAGCAAGCCACCAGAGGGAGCAGAGGACCTCTACTTTCCCACACAGTACTCTCAGTCTACATGGGGGCAGTTCAAATCCTGCCTCTGGAAGCAATGGTGGACCTACTGGAGAAGTCCTGAGTACAATCTTGTTCGCTACTTCTTCAGCTTTGCAGCTGCTCTTGTGGTTGGCACCATCTTCTGGCATGTTGGCACTAAAAGGTCAAATGCAACTGACCTAACAATGGTCATTGGAGCAATGTACATGTCTGTCATGTTTGTCGGAGTAAACAACTGCATGACAGTACAGCCAATTGTAGCCATTGAACGAACCGTGTTCTATCGAGAAAGAGCAGCTGGAATGTACCATGCTTTCCCATATGCCATTGCACAGGTGGTAGCTGAAATACCATATGTTTTCGTTCAAGCCACATACTATTCAGTCATAGTGTATGCCCTGGCATGCTTCCAATGGACACTGGCAAAGTTCTTCTGGTTCCTCTTCATCACCTTCTTCTCCTTCCTCTACTTCACATACTATGGAATGATGACAGTTTCCATCACAGCAAATCATGAAGAAGCAGCCATAGTAGCTTCAGCTTTTGTTTCACTCTTCACCCTCTTCTCAGGCTTCTTCATCCCCAGACCTAGAATTCCCAAGTGGTGGGTATGGTACTATTGGATATGCCCAGTGGCGTGGACAGTATACGGATTGATTGTGTCACAGTATGGGGACATGGAGGAGACCATCAACGTGGCTGGGATTGAGCCAAGCCCAAGCATCAAATGGTATGTGGAAAGCCACTTTGGGTATGATCTGGATTTCATGGGGGCAGTTGCTGGCATTTTGGTAGGCTTTGCTGTCTTCTTTGCCTTCTTGTTTGGGGTCTGCATCCAGAAATTGAACTTCCAACGGAGGTAG


Protein sequences

Name Description Sequence
Vvi.8457 translated coding region predicted by ESTScan from UniGene Vvi.8457

MDTINGGAESQPPTSFPEKDEEEAVRWGALEKLPTYDRLRTSILKSVVEGESEEKSGRVVYKEVDVGKLDESDRENFIHRNFKVADDDNEKFLQRLRNRFDRVGVELPKVEVRIERLRVEVDCYVGTRALPTLTNTARNMLESALGLFGIILAKRTNHTILRDISAIIKPSRMTLLLGPPSSGKTTLLLALAGMLDQSLKVKGEITYNGCNFNEFVPQKTSAYISQNNVHLGELTVKETLDYSARFQGIGSRRELLTELVKKEEEIGIFTDTNVDLFLKACAMEGDESSIITDYILKILGLDVCKDTLVGNEMMRGISGGQKKRVTSGEMIVGPAKFLLMDEISTGLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPREHVLHFFQNCGFQCPERKGTADFLQEVTSKKDQEQYWADSTEPYRYVSVTEFATLFKAFHVGLQLEDDLKLPYDKSQCHKSALVFKKCTIPKMQLLKTSFDKEWLLLKRTSFVYIFKGIQLIIVAFIVSTVFLRTTLDVSYDDGPLYIGAIIFSIIINMFNGFAELSLTIARLPVFYKHRDLLFYPAWAFTLPSCLLRIPISVVESVIWTVIVYYTIGYAPETSRFFKQMLMIFLIQQMASGVFRLIGGVCRSMIVAHTGGALVLFIVFLLSGFILPLDEIPKWWNWGHWISPLSYGFKAMTINEMLSPRWMNKLGPDNSTLLGVAVLDNVDVESESYWYWIGAACLLGFTILFNILFTFSLMYLNPLGKPQAIISEEAAKEQEPNQGDQTTIPKKTGIKRGMILPFLPLSMSFDNVNYYVDMPKEMKSQGVTEHRLQLLREVTGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGGELIYSGPLGQNSHKIIEYFEAIPGVLKIKEKYNPAAWMLEVSSASAEVQLGINFADYLIKSPQYQENKALVKELSKPPEGAEDLYFPTQYSQSTWGQFKSCLWKQWWTYWRSPEYNLVRYFFSFAAALVVGTIFWHVGTKRSNATDLTMVIGAMYMSVMFVGVNNCMTVQPIVAIERTVFYRERAAGMYHAFPYAIAQVVAEIPYVFVQATYYSVIVYALACFQWTLAKFFWFLFITFFSFLYFTYYGMMTVSITANHEEAAIVASAFVSLFTLFSGFFIPRPRIPKWWVWYYWICPVAWTVYGLIVSQYGDMEETINVAGIEPSPSIKWYVESHFGYDLDFMGAVAGILVGFAVFFAFLFGVCIQKLNFQRR

Domains

Domain Start-End Description Sequence

Seg: seg
45-60 seg

KSVVEGESEEKSGRVV

Seg: seg
110-121 seg

VEVRIERLRVEV

superfamily: SSF52540
141-422 P-loop containing nucleoside triphosphate hydrolases

LESALGLFGIILAKRTNHTILRDISAIIKPSRMTLLLGPPSSGKTTLLLALAGMLDQSLKVKGEITYNGCNFNEFVPQKTSAYISQNNVHLGELTVKETLDYSARFQGIGSRRELLTELVKKEEEIGIFTDTNVDLFLKACAMEGDESSIITDYILKILGLDVCKDTLVGNEMMRGISGGQKKRVTSGEMIVGPAKFLLMDEISTGLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPREHVLHFFQNCGFQCPERKGT

ProfileScan: PS50893
IPR003439
145-418 ABC_TRANSPORTER_2
ABC transporter-like

LGLFGIILAKRTNHTILRDISAIIKPSRMTLLLGPPSSGKTTLLLALAGMLDQSLKVKGEITYNGCNFNEFVPQKTSAYISQNNVHLGELTVKETLDYSARFQGIGSRRELLTELVKKEEEIGIFTDTNVDLFLKACAMEGDESSIITDYILKILGLDVCKDTLVGNEMMRGISGGQKKRVTSGEMIVGPAKFLLMDEISTGLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPREHVLHFFQNCGFQCPE

Gene3D: G3DSA:3.40.50.300
157-407 no description

NHTILRDISAIIKPSRMTLLLGPPSSGKTTLLLALAGMLDQSLKVKGEITYNGCNFNEFVPQKTSAYISQNNVHLGELTVKETLDYSARFQGIGSRRELLTELVKKEEEIGIFTDTNVDLFLKACAMEGDESSIITDYILKILGLDVCKDTLVGNEMMRGISGGQKKRVTSGEMIVGPAKFLLMDEISTGLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPREHVLH

HMMSmart: SM00382
IPR003593
170-402 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PSRMTLLLGPPSSGKTTLLLALAGMLDQSLKVKGEITYNGCNFNEFVPQKTSAYISQNNVHLGELTVKETLDYSARFQGIGSRRELLTELVKKEEEIGIFTDTNVDLFLKACAMEGDESSIITDYILKILGLDVCKDTLVGNEMMRGISGGQKKRVTSGEMIVGPAKFLLMDEISTGLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPR

HMMPfam: PF00005
IPR003439
185-342 ABC_tran
ABC transporter-like

TTLLLALAGMLDQSLKVKGEITYNGCNFNEFVPQKTSAYISQNNVHLGELTVKETLDYSARFQGIGSRRELLTELVKKEEEIGIFTDTNVDLFLKACAMEGDESSIITDYILKILGLDVCKDTLVGNEMMRGISGGQKKRVTSGEMIVGPAKFLLMDE

Seg: seg
254-265 seg

ELLTELVKKEEE

HMMPanther: PTHR19241:SF10
346-1416 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPREHVLHFFQNCGFQCPERKGTADFLQEVTSKKDQEQYWADSTEPYRYVSVTEFATLFKAFHVGLQLEDDLKLPYDKSQCHKSALVFKKCTIPKMQLLKTSFDKEWLLLKRTSFVYIFKGIQLIIVAFIVSTVFLRTTLDVSYDDGPLYIGAIIFSIIINMFNGFAELSLTIARLPVFYKHRDLLFYPAWAFTLPSCLLRIPISVVESVIWTVIVYYTIGYAPETSRFFKQMLMIFLIQQMASGVFRLIGGVCRSMIVAHTGGALVLFIVFLLSGFILPLDEIPKWWNWGHWISPLSYGFKAMTINEMLSPRWMNKLGPDNSTLLGVAVLDNVDVESESYWYWIGAACLLGFTILFNILFTFSLMYLNPLGKPQAIISEEAAKEQEPNQGDQTTIPKKTGIKRGMILPFLPLSMSFDNVNYYVDMPKEMKSQGVTEHRLQLLREVTGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGGELIYSGPLGQNSHKIIEYFEAIPGVLKIKEKYNPAAWMLEVSSASAEVQLGINFADYLIKSPQYQENKALVKELSKPPEGAEDLYFPTQYSQSTWGQFKSCLWKQWWTYWRSPEYNLVRYFFSFAAALVVGTIFWHVGTKRSNATDLTMVIGAMYMSVMFVGVNNCMTVQPIVAIERTVFYRERAAGMYHAFPYAIAQVVAEIPYVFVQATYYSVIVYALACFQWTLAKFFWFLFITFFSFLYFTYYGMMTVSITANHEEAAIVASAFVSLFTLFSGFFIPRPRIPKWWVWYYWICPVAWTVYGLIVSQYGDMEETINVAGIEPSPSIKWYVESHFGYDLDFMGAVAGILVGFAVFFAFLFGVCIQKLNFQRR

HMMPanther: PTHR19241
346-1416 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTTLQIVRCMQQIAHFTHSTVFMSLLQPDPETFNLFDDVILLSEGQIVYQGPREHVLHFFQNCGFQCPERKGTADFLQEVTSKKDQEQYWADSTEPYRYVSVTEFATLFKAFHVGLQLEDDLKLPYDKSQCHKSALVFKKCTIPKMQLLKTSFDKEWLLLKRTSFVYIFKGIQLIIVAFIVSTVFLRTTLDVSYDDGPLYIGAIIFSIIINMFNGFAELSLTIARLPVFYKHRDLLFYPAWAFTLPSCLLRIPISVVESVIWTVIVYYTIGYAPETSRFFKQMLMIFLIQQMASGVFRLIGGVCRSMIVAHTGGALVLFIVFLLSGFILPLDEIPKWWNWGHWISPLSYGFKAMTINEMLSPRWMNKLGPDNSTLLGVAVLDNVDVESESYWYWIGAACLLGFTILFNILFTFSLMYLNPLGKPQAIISEEAAKEQEPNQGDQTTIPKKTGIKRGMILPFLPLSMSFDNVNYYVDMPKEMKSQGVTEHRLQLLREVTGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGGELIYSGPLGQNSHKIIEYFEAIPGVLKIKEKYNPAAWMLEVSSASAEVQLGINFADYLIKSPQYQENKALVKELSKPPEGAEDLYFPTQYSQSTWGQFKSCLWKQWWTYWRSPEYNLVRYFFSFAAALVVGTIFWHVGTKRSNATDLTMVIGAMYMSVMFVGVNNCMTVQPIVAIERTVFYRERAAGMYHAFPYAIAQVVAEIPYVFVQATYYSVIVYALACFQWTLAKFFWFLFITFFSFLYFTYYGMMTVSITANHEEAAIVASAFVSLFTLFSGFFIPRPRIPKWWVWYYWICPVAWTVYGLIVSQYGDMEETINVAGIEPSPSIKWYVESHFGYDLDFMGAVAGILVGFAVFFAFLFGVCIQKLNFQRR

HMMPfam: PF01061
IPR013525
497-707 ABC2_membrane
ABC-2 type transporter

LLKTSFDKEWLLLKRTSFVYIFKGIQLIIVAFIVSTVFLRTTLDVSYDDGPLYIGAIIFSIIINMFNGFAELSLTIARLPVFYKHRDLLFYPAWAFTLPSCLLRIPISVVESVIWTVIVYYTIGYAPETSRFFKQMLMIFLIQQMASGVFRLIGGVCRSMIVAHTGGALVLFIVFLLSGFILPLDEIPKWWNWGHWISPLSYGFKAMTINE

HMMPfam: PF08370
IPR013581
713-778 PDR_assoc
Plant PDR ABC transporter associated

WMNKLGPDNSTLLGVAVLDNVDVESESYWYWIGAACLLGFTILFNILFTFSLMYLNPLGKPQAIIS

superfamily: SSF52540
806-1053 P-loop containing nucleoside triphosphate hydrolases

ILPFLPLSMSFDNVNYYVDMPKEMKSQGVTEHRLQLLREVTGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGGELIYSGPLGQ

ProfileScan: PS50893
IPR003439
814-1067 ABC_TRANSPORTER_2
ABC transporter-like

MSFDNVNYYVDMPKEMKSQGVTEHRLQLLREVTGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGGELIYSGPLGQNSHKIIEYFEAIPG

Gene3D: G3DSA:3.40.50.300
837-1053 no description

HRLQLLREVTGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGGELIYSGPLGQ

HMMSmart: SM00382
IPR003593
851-1043 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKTGG

HMMPfam: PF00005
IPR003439
866-994 ABC_tran
ABC transporter-like

TTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISSYCEQNDIHSPQVTVIESLIYSAFLRLPKEVPDKEKMIFVNEVMELVELSSIKYALVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTS

HMMPfam: PF01061
IPR013525
1140-1353 ABC2_membrane
ABC-2 type transporter

QFKSCLWKQWWTYWRSPEYNLVRYFFSFAAALVVGTIFWHVGTKRSNATDLTMVIGAMYMSVMFVGVNNCMTVQPIVAIERTVFYRERAAGMYHAFPYAIAQVVAEIPYVFVQATYYSVIVYALACFQWTLAKFFWFLFITFFSFLYFTYYGMMTVSITANHEEAAIVASAFVSLFTLFSGFFIPRPRIPKWWVWYYWICPVAWTVYGLIVSQY

Seg: seg
1273-1290 seg

FFWFLFITFFSFLYFTYY

Seg: seg
1387-1406 seg

GAVAGILVGFAVFFAFLFGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox