PRGDB00078699 (Vvi.8676)

From PRG Wiki
Jump to: navigation, search
Vvi.8676
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225459991 (XM_002270274)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100243063 (LOC100243063), mRNA

DNA Sequence

ATGGCTTCCATGTGCAACCTAATATCCTCTTCTTCTACTTCTGTCCTTCGATGGAATCATGATGTTTTCTTGAGTTTTAGAGGTGAAGATACTCGCTACAAGTTTACTGATCATCTGTACGCAGCATTGGTTAATAAAGGCATACGAACTTTTAGAGATGATAAACTCAAGAGAGGAGAAGAGATCGCACCGTTACTCTTGAAAGTTATTGAAGAATCAAGGCTTTCCATAGTTGTATTTTCAGAAAATTATGCTAGTTCTAGATGGTGTTTAGATGAGCTGGTAAAAATCATGGAGTGCAGACAAAAAATTAGACAAATATTGGTACCAATTTTCTACCATGTGGATCCGTCCGATCTTCGGACACAAAAGGGGAGTTTTGAAAAATCTTTTGCCAGCCATGAAAGACATGGAAGGGATTCCAAGGAGAAGATACAAAGGTGGAGGGCTGCATTGACTGAAGCAAGTAATCTATCAGGATGGCATCTCTTTGAAGGGTAATTTAAATTTCTTCCTTTTTTTCATTTATAGTTGGATTTTATTCACTTGTACATGAATTCTAGAGTCTTATTATTATAATGATAGGCTGAAAGCCATTAGTTATGGACAAGTTCattaatattattaattataattattatgattttttacttttattGTCTGTCAGAGCAACAATAGAGTTAGTATAAAAAGAGTAGTAGAATAACAATTATATGGCTTTCTAATTATAATAAATGATAAAATAATATGTGGAACTTATTAAATGTCAATGAAGAAGttttaaaattttagagaataattaataataaaataatcaaatCAAA


Protein sequences

Name Description Sequence
Vvi.8676 translated coding region predicted by ESTScan from UniGene Vvi.8676

MASMCNLISSSSTSVLRWNHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALTEASNLSGWHLFEG

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
8-161 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ISSSSTSVLRWNHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALTEASNLSGW

Gene3D: G3DSA:3.40.50.10140
17-153 no description

RWNHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALT

ProfileScan: PS50104
IPR000157
18-158 TIR
Toll-Interleukin receptor

WNHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALTEASNL

HMMSmart: SM00255
IPR000157
19-158 Toll
Toll/interleukin-1 receptor homology (TIR) domain

NHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALTEASNL

HMMPfam: PF01582
IPR000157
22-153 TIR
Toll-Interleukin receptor

VFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALT

HMMPanther: PTHR23155:SF300
23-160 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE

FLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALTEASNLSG

HMMPanther: PTHR23155
23-160 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSFRGEDTRYKFTDHLYAALVNKGIRTFRDDKLKRGEEIAPLLLKVIEESRLSIVVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERHGRDSKEKIQRWRAALTEASNLSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox