PRGDB00078735 (Vvi.9786)

From PRG Wiki
Jump to: navigation, search
Vvi.9786
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225470484 (XM_002263371)
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100244283 (LOC100244283), mRNA

DNA Sequence

ATGGCTTTGGCGCTTTTTGGAGGGGCTGCTCTGGGAGCAGCATTTCAGGGTTTGCTAACGGCGGTCATAAAAGTAAGTAAAAAGTTTGCCGGGTTCGACTCCATCCTCAAAAAACTCGAAGCCACACTCGAACGCATAAAGCCATATATTCAAGAGATGGAAAGGTTGAACGACGAGTTGGATCGTCCAAGGATGGAAATGGAGAAGTTGATCCAAATCTTACAAGATGGAGAGAAGCTAATCCAAGACTGCTCTCGCTGCTACTGCTACCAGAGGATAGGGTACGCCAATAAAATTAAAGCCCTCGATGCCTCTCTTCTTAGATTGTTTCAGGTGGATGTGCACGCCCAAGTCAGTAGGGACGTCAAGGAGATTCTGGCCATTCTCAAATCAAATGGATGCAATTGGAATTACAGAGGGnnnnnnnnnnnnnnnnnnnCTGGTCCACCGGAATTTATGGTGGGATTAGATGTGCCTCTCAAAGAATTGAAGCGGCGGCTATGTGAGGATGGGGAATCAAGGATTGTGATCAGGGCTCCTGGAGGATGTGGGAAAACCACTATGGCTAAAGAGCTTTGTCACGACAATCAAGTCAGAGAATATTTTAAGCACATTTTGTATGCCACGGTGTCAAGACCGCCCAACCTAATTGCCATCATTACGAAACTATTTTGGGACGAGGATGAACGAGTGCCAAAGTTTCAAAATGAGGAAGATGCAGCCAATCAAATGGAACTGAAACTGAAGAAGAAAGAAGAATCCGGTGATGTACTGTTGGTCCTAGATGATGTTTGGTGTGGATCAGAATCCCTCTTAGCCAAGTTCAAGTTCCGGACATCAAAATCCAAGGTCGTCGTTACATCAAGAAATGAATTTCCAGAATTTGGCTCTACATATGACTTGGAATTGTTGAATGACGACGATGCCATGGCTCTTTTTCGTCACTCAGCAATCCCCCAGAATGGAAGCTGTAATTACACACCGACTGATAGGCTTGTGAAGAAGATAGTGGGGCACTGCAAGGGAATTCCACTGGCCCTGGAAGTCGTTGGCAGATCACTCCATGGGCGGCCTGTAGAGATCTGGAGAAGCCGACTGAAGAAATTATCCGAAGGTCAATCCATTGTCAATTCTGAAATTATTCTGCGTAAATGTCTTCAAAGTAGCATAGACGCCCTAAATGACGAGGATGTTATGCTGAAGGAGTGTTTTATGGACTTGGGCTCCTTTCCTGAAGACCAGAAAATCCCTGCCACTGCTCTTATAGACATGTGGGCGGAATTGTACAACCTAGATAAAGACGGGATTGATGCCATTGCCAACCTTCACGAACTCTCCTCTCGGACTCTGCTTAATCTTGCGGTCACGAGGAATGATGCAAGTGAGATTGATGGATGGTACAGCGATGCCATTGTGATGCAGCATGATGATCTCAGGGATCTAGCCATTTACCAGAGCAAACAGGAGCTCATAAAAGAGAGGAAAAGACTATTTGTGGACTTTAGCAAACTCCCCGAGTGGTGGACTGAAGAAGAGCAACCCCAATCAAGTGCTCGCCTTGTGTCCATCTCTACAGGTGAAATGTTTTCCTCAAGCCAGGGCGACCTGCAAATTCCTGAAACCGAGGTTCGCTGGTGCAACATGCAAATTCCTGACCCTGAGGTTCTAATACTGAACTTTAATCAGACACAGAAAAAATACAAATTGCCTGAGTTCATTAAGCAAATGGATAAACTGAAGGTTCTAATAGTAACAAATTATGGTATCGCAGTTGAACTGACTAATTTTTCAGTACTCGGCTCCTTATCCAATCTAAAGAGAATCAGGTTAGAGAAAGTTTCAATTCCAACACTGTGCAACACCAGTATGGGATTGAAGAATTTGGAGAAGATATCCTTAGTCATGTGTTATAAGATTGGTCAGGCTTTTGCAAGTAGTACCATCCAGATTACAGAAATGTTAGCAAACCTTAGGGAAATCAACATTGACTACTGTAATGACTTGGTGGAATTACCAGAGGGGTTTTGTGATTTAGTCCGACTGAATAAGCTGAGCATCAGCAACTGCCCTAAGCTGTCTGCACTGCCGGAAGGAATAGGGAAGCTTGCAAATCTGGAAGTGCTAAGGCTTCGTGCCTGTGCACGGGTGTCAAAATTGCCAGACTCAATCGGAAGCCTCCACAAGTTGAGCTTTCTTGATATAACTGGTTGTGTACGACTGTCGGAAATGCCGAACCGAATAGACGGGTTGCGTGATCTAAGAGAGTTCCACATGAGAAGGTGCCCTGGTTTGTTCGAGCTGCCATCATCAGTGAAGGATCTCGTGGATTTGGAGAGTGTAATATGCGATGAAAGTACTGTCCTGCTGTGGGAATCTTTTAAGCACTTCCTCCCCAATCTCACCCTATCAGTGCGTGAAGAAAGTATCAACTGGCATTTGCTATAAAATCCTAGTTTCTCGaaaaaaaaTTTCTCCTCAACAGACGAGGGAGTGCAAAATGGAAGCAGCTGTACATGTAAGCATTGGATTTTTCGTTTCtttttttttttttttttATTCTTATTTATCATTTGCTTGATCCGTAATGTTAACTTTCATACATATAATTTAAAGATCTTCCAGTGAGCCTTTTAATGTTCT


Protein sequences

Name Description Sequence
Vvi.9786 translated coding region predicted by ESTScan from UniGene Vvi.9786

MALALFGGAALGAAFQGLLTAVIKVSKKFAGFDSILKKLEATLERIKPYIQEMERLNDELDRPRMEMEKLIQILQDGEKLIQDCSRCYCYQRIGYANKIKALDASLLRLFQVDVHAQVSRDVKEILAILKSNGCNWNYRGXXXXXXXGPPEFMVGLDVPLKELKRRLCEDGESRIVIRAPGGCGKTTMAKELCHDNQVREYFKHILYATVSRPPNLIAIITKLFWDEDERVPKFQNEEDAANQMELKLKKKEESGDVLLVLDDVWCGSESLLAKFKFRTSKSKVVVTSRNEFPEFGSTYDLELLNDDDAMALFRHSAIPQNGSCNYTPTDRLVKKIVGHCKGIPLALEVVGRSLHGRPVEIWRSRLKKLSEGQSIVNSEIILRKCLQSSIDALNDEDVMLKECFMDLGSFPEDQKIPATALIDMWAELYNLDKDGIDAIANLHELSSRTLLNLAVTRNDASEIDGWYSDAIVMQHDDLRDLAIYQSKQELIKERKRLFVDFSKLPEWWTEEEQPQSSARLVSISTGEMFSSSQGDLQIPETEVRWCNMQIPDPEVLILNFNQTQKKYKLPEFIKQMDKLKVLIVTNYGIAVELTNFSVLGSLSNLKRIRLEKVSIPTLCNTSMGLKNLEKISLVMCYKIGQAFASSTIQITEMLANLREINIDYCNDLVELPEGFCDLVRLNKLSISNCPKLSALPEGIGKLANLEVLRLRACARVSKLPDSIGSLHKLSFLDITGCVRLSEMPNRIDGLRDLREFHMRRCPGLFELPSSVKDLVDLESVICDESTVLLWESFKHFLPNLTLSVREESINWHLL

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-148 RPW8
Powdery mildew resistance protein, RPW8 domain

MALALFGGAALGAAFQGLLTAVIKVSKKFAGFDSILKKLEATLERIKPYIQEMERLNDELDRPRMEMEKLIQILQDGEKLIQDCSRCYCYQRIGYANKIKALDASLLRLFQVDVHAQVSRDVKEILAILKSNGCNWNYRGXXXXXXXG

Seg: seg
2-19 seg

ALALFGGAALGAAFQGLL

HMMPfam: PF05659
IPR008808
5-130 RPW8
Powdery mildew resistance protein, RPW8 domain

LFGGAALGAAFQGLLTAVIKVSKKFAGFDSILKKLEATLERIKPYIQEMERLNDELDRPRMEMEKLIQILQDGEKLIQDCSRCYCYQRIGYANKIKALDASLLRLFQVDVHAQVSRDVKEILAILK

Coil: coil
39-60 coiled-coil

LEATLERIKPYIQEMERLNDEL

superfamily: SSF52540
136-369 P-loop containing nucleoside triphosphate hydrolases

WNYRGXXXXXXXGPPEFMVGLDVPLKELKRRLCEDGESRIVIRAPGGCGKTTMAKELCHDNQVREYFKHILYATVSRPPNLIAIITKLFWDEDERVPKFQNEEDAANQMELKLKKKEESGDVLLVLDDVWCGSESLLAKFKFRTSKSKVVVTSRNEFPEFGSTYDLELLNDDDAMALFRHSAIPQNGSCNYTPTDRLVKKIVGHCKGIPLALEVVGRSLHGRPVEIWRSRLKKL

Seg: seg
140-148 seg

GXXXXXXXG

HMMPanther: PTHR23155:SF239
153-778 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

MVGLDVPLKELKRRLCEDGESRIVIRAPGGCGKTTMAKELCHDNQVREYFKHILYATVSRPPNLIAIITKLFWDEDERVPKFQNEEDAANQMELKLKKKEESGDVLLVLDDVWCGSESLLAKFKFRTSKSKVVVTSRNEFPEFGSTYDLELLNDDDAMALFRHSAIPQNGSCNYTPTDRLVKKIVGHCKGIPLALEVVGRSLHGRPVEIWRSRLKKLSEGQSIVNSEIILRKCLQSSIDALNDEDVMLKECFMDLGSFPEDQKIPATALIDMWAELYNLDKDGIDAIANLHELSSRTLLNLAVTRNDASEIDGWYSDAIVMQHDDLRDLAIYQSKQELIKERKRLFVDFSKLPEWWTEEEQPQSSARLVSISTGEMFSSSQGDLQIPETEVRWCNMQIPDPEVLILNFNQTQKKYKLPEFIKQMDKLKVLIVTNYGIAVELTNFSVLGSLSNLKRIRLEKVSIPTLCNTSMGLKNLEKISLVMCYKIGQAFASSTIQITEMLANLREINIDYCNDLVELPEGFCDLVRLNKLSISNCPKLSALPEGIGKLANLEVLRLRACARVSKLPDSIGSLHKLSFLDITGCVRLSEMPNRIDGLRDLREFHMRRCPGLFELPSSVKDLVDLE

HMMPanther: PTHR23155
153-778 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVGLDVPLKELKRRLCEDGESRIVIRAPGGCGKTTMAKELCHDNQVREYFKHILYATVSRPPNLIAIITKLFWDEDERVPKFQNEEDAANQMELKLKKKEESGDVLLVLDDVWCGSESLLAKFKFRTSKSKVVVTSRNEFPEFGSTYDLELLNDDDAMALFRHSAIPQNGSCNYTPTDRLVKKIVGHCKGIPLALEVVGRSLHGRPVEIWRSRLKKLSEGQSIVNSEIILRKCLQSSIDALNDEDVMLKECFMDLGSFPEDQKIPATALIDMWAELYNLDKDGIDAIANLHELSSRTLLNLAVTRNDASEIDGWYSDAIVMQHDDLRDLAIYQSKQELIKERKRLFVDFSKLPEWWTEEEQPQSSARLVSISTGEMFSSSQGDLQIPETEVRWCNMQIPDPEVLILNFNQTQKKYKLPEFIKQMDKLKVLIVTNYGIAVELTNFSVLGSLSNLKRIRLEKVSIPTLCNTSMGLKNLEKISLVMCYKIGQAFASSTIQITEMLANLREINIDYCNDLVELPEGFCDLVRLNKLSISNCPKLSALPEGIGKLANLEVLRLRACARVSKLPDSIGSLHKLSFLDITGCVRLSEMPNRIDGLRDLREFHMRRCPGLFELPSSVKDLVDLE

HMMPfam: PF00931
IPR002182
161-427 NB-ARC,NBS
NB-ARC

KELKRRLCEDGESRIVIRAPGGCGKTTMAKELCHDNQVREYFKHILYATVSRPPNLIAIITKLFWDEDERVPKFQNEEDAANQMELKLKKKEESGDVLLVLDDVWCGSESLLAKFKFRTSKSKVVVTSRNEFPEFGSTYDLELLNDDDAMALFRHSAIPQNGSCNYTPTDRLVKKIVGHCKGIPLALEVVGRSLHGRPVEIWRSRLKKLSEGQSIVNSEIILRKCLQSSIDALNDEDVMLKECFMDLGSFPEDQKIPATALIDMWAE

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

RIVIRAPGGCGKTTMA

Coil: coil
234-255 coiled-coil

FQNEEDAANQMELKLKKKEESG

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

KEESGDVLLVLDDVW

FPrintScan: PR00364
IPR000767
340-354 DISEASERSIST
Disease resistance protein

CKGIPLALEVVGRSL

Gene3D: G3DSA:3.80.10.10
554-780 no description

EVLILNFNQTQKKYKLPEFIKQMDKLKVLIVTNYGIAVELTNFSVLGSLSNLKRIRLEKVSIPTLCNTSMGLKNLEKISLVMCYKIGQAFASSTIQITEMLANLREINIDYCNDLVELPEGFCDLVRLNKLSISNCPKLSALPEGIGKLANLEVLRLRACARVSKLPDSIGSLHKLSFLDITGCVRLSEMPNRIDGLRDLREFHMRRCPGLFELPSSVKDLVDLESV

superfamily: SSF52047
568-801 RNI-like,LRR

KLPEFIKQMDKLKVLIVTNYGIAVELTNFSVLGSLSNLKRIRLEKVSIPTLCNTSMGLKNLEKISLVMCYKIGQAFASSTIQITEMLANLREINIDYCNDLVELPEGFCDLVRLNKLSISNCPKLSALPEGIGKLANLEVLRLRACARVSKLPDSIGSLHKLSFLDITGCVRLSEMPNRIDGLRDLREFHMRRCPGLFELPSSVKDLVDLESVICDESTVLLWESFKHFLPNLT

FPrintScan: PR00364
IPR000767
724-740 DISEASERSIST
Disease resistance protein

GSLHKLSFLDITGCVRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox