PRGDB00078748 (Vvi.10094)

From PRG Wiki
Jump to: navigation, search
Vvi.10094
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225448268 (XM_002270301)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100242443 (LOC100242443), mRNA

DNA Sequence

ATGGCTTCCACAAGCTCCTTTAGAGCCTCTTCTTCTTCTACTCCTTCCATCCCTCAAACAAGTACTTATGATGTTTTCTTGAGTTTTAGAGGCGCAGACACCCGCTATAATTTCACTGATCACCTCTACAAAGCTTTGGATAGGAGAGGTATTCGCACCTTCAGAGACGATACACTCAGGAGAGGAGAAGCGATTGATCCAGAACTCTTGAAAGCCATTGAAGGATCAAGGTCTTCCGTAATTGTTTTCTCTGAAAACTATGCTCATTCGAGATCGTGTTTGGATGAGTTGGTAAAGATCATGGAGTGCCAGAAAGATCTGGGACATACTGTTATCCCAATTTTCTATCATGTGGATCCATCCCATGTACGAAAGCAAGAAGGAAGTTTTGGAGCGGCCTTTGCCGGTTATGAAGAAAACTGGAAGGACAAGATACCAAGATGGAGGACGGCCTTGACGGAAGCAGCCAATCTTTCTGGATGGCATCTACAAGATGGGTATGAGTCCGACAATATTAAGAAAATAACTGATGACATATTCCGTCAATTGAATTGTAAGAGGCTTGATGTTGGTGACAATTTAGTTGGTATAGATTTTCGTCTAAAAGAGATGGATTTGCGGTTAGATATGGAATCGGATGCTGTTCGTATTGTTGGGATATATGGAATTGGGGGGATAGGTAAGACAACCATTGCGAGGGTTATATATAATAACCTTTCTTCTGAATTTGAATGTATGAGCTTTCTTGAAAATATTAGGGGGGTTTCCAATACCCGAGGTTTACCTCACTTACAAAATCAACTTCTTGGTGATATCCTAGGGGGAGAGGGAATTCAAAATATAAATTGTGTTAGCCATGGAGCAATTATGATAAAATCCATTCTCTCATCCAAAAGAGTTTTTATTGTTCTCGATGATGTTGACAATTTAGTCCAATTAGAATATTTACTAAGAAATCGTGGATGGCTTGGAAAAGGAAGTAGAGTCATCATAACAACTAGAAATAAACATTTGTTAAACGTACAAGGAGTGGATGACTTATATGAGGTTGATCAATTGAATTTTAACGAAGCTTATGAACTTTTCAGTTTGTATGCCTTCAAACAAAATCATCCCAAATCAGGTTTTGTGAACCTCTCATACAGCGCAGTAAGTTATTGTCAACACCTTCCATTGGCTTTGAAAGTTCTAGGTTCTCTCTTGTTCAGCAAGACAATACCTCAATGGGAAAGTGAATTGCTTAAACTGGAAAGAGTACCTGAAGCAGAAATACATAATGTGCTTAAAAGAAGCTATGATGGATTAGATCGTACAGAAAAAAATATATTCCTTGATATTGCATGTTTTTTTAAAGATGAAGATAGAGATTTTGTGTTAAGAATATTGGATGGTTGTAATTTCCATGCGGAAAGAGGAATAGAAAATCTAATTGATAAGTCTCTTATAACTCTCTCATACAATCAAATACGTTTGCATGATTTGATACAACAAATGGGTTGGGAAATTGTTCGTGAAAATTTTCCTAATGAGCCAGACAAATGGAGTAGATTGTGGGATCCCCATGATATTGAACGTGCGCTTACAACATATGAGGGAATAAAAGGAGTTGAAACAATTAACTTAGACCTGTCTAAGTTAAAAAGAGTACGCTTCAATTCAAATGTTTTCTCAAAGATGAGTAGACTTCGATTGCTCAAGGTTCATTCAAATGTCAATCTAGATCATGATTTGTTTTATGATAGTGAGGAGTTGGAGGAGGGCTACTCGGAGATGTATAAGTTAGAAGAAATGCTCTTCAATCGAAATTTTGTTACAGTTAGATTGGACAAAGTTCATTCAGATCATGATTCTGAAGATATTGAGGAGGAGGAGGAAGAAGAAGATATAATGGCTTCTGAGGATTATCATGATTATGAAGTTGCAATCCCTTGTATGGTCGGTTATGATTTTGTAATGGAAACTGCTTCTAAAATGCGACTTGGCCTGGATTTTGAAATTCCTTCTTATGAGTTAAGGTATCTTTATTGGGATGGGTATCCTTTAGATTCTTTACCATCAAATTTTGATGGAGAGAACCTTGTTGAACTTCACTTGAAGTGTAGCAACATAAAACAACTATGGCAAGGGAATAAGTATCTTGAAAGTTTAAAGGTCATCGATCTAAGTTACTCAACGAAGCTCATTCAAATGCCAGAATTCTCAAGCCTGTCAAATTTGGAGAGACTAATTCTTAAAGGTTGTGTAAGCTTGATCGATATTCACCCATCTATTGGAGGTCTCAAGAAGCTTACTACCTTAAATTTGAAGTGGTGTCTAAAGATTAAGGGTTTGCCAAGTAGCATTAGCATGTTGGAATCTCTTCAATTACTTGATCTCTCCAAGTGTTCAAGCTTTTGCAAGTTCTCAGAAATTCAAGGAAATATGAGATGTTTGCGGGAACCATATTTGAAGGAGACTGCTACTAAAGATCTTCCGACTAGTATTGGAAACTCGAGATCTTTTTGGGATCTCTATCCTTGTGGACGCTCAAACTTAGAGAAATTTCTGGTGATCCAACAAAATATGAGAAGTTTACGGCTTCTATATTTGTGCAAGACTGCTATTAGAGAACTTCCAAGCAGCATTGACTTAGAATCTGTTGAGATTCTTGATCTCTCTAATTGTTTTAAGTTTGAGAAATTTTCGGAGAATGGAGCAAACATGAAAAGTTTACGGCAGCTTGTTTTAACCAATACTGCTATTAAAGAACTCCCAACAGGTATTGCTAACTGGGAATCTCTTCGAACTCTTGATCTTTCTAAATGCTCAAAGTTTGAGAAATTTCCAGAGATCCAAGGAAATATGACAAGTTTAAAGAAGCTTCTTTTAAACAATACTGCTATCAAGGGTCTTCCTGATAGCATTGGATACTTGAAATCTCTAGAGATTCTTAATGTCTCTGATTGCTCAAAGTTTGAAAATTTTCCGGAGAAGGGAGGGAACATGAAAAGTTTAAAGGAGCTTTCTTTAAAAAATACTGCTATTAAGGATCTGCCTGATAGCATTGGAGACTTGGAATCTCTTTGGTTTCTTGATCTCACTAATTGCTCAAAGTTTGAGAAATTTCCGGAGAAGGGAGGGAACATGAAAAGCTTAAGGGTGCTTTATTTAAATGATACTGCTATTAAGGATTTGCCTGATAGCATTGGAGACTTGGAATCTCTTGAGTTTCTTGATCTCTCTGATTGCTCAAAGTTTGAGAAATTTCCGGAGAAGGGAGGGAACATGAAAAGCTTAAAGAAGCTTTCTTTAAAAAATACTGCTATTAAGGATCTGCCTTATAGCATTAGAGACTTGGAATCTCTTTGGTTTCTTGATCTCTCTGATTGCTCAAAGTTTGAGAAATTTCCGGAGAAGGGAGGGAACATGAAAAGTTTAATGGATCTTCGTTTAAAAAATACTGCTATTAAGGATCTTCCCAACAACATTTCTGGGTTGAAATTTCTTGAAACACTCAACCTCGGTGGTTGCTCAGACCTGTGGGAAGGATTAATAAGTAATCAGCTTTGCAACCTGCAAAAAATTAATATTCCGGAGTTGAAATGCTGGAAACTCAATGCTGTTATTCCTGAAAGTAGTGGAATTCTAGAGTGGATAAGGTATCATATCTTGGGAAGTGAAGTAACAGCAAAGCTTCCAATGAATTGGTACGAAGATCTTGACTTCCCAGGATTTGTTGTATCATGTGTTTATCGGGATATTCGTACATCTGATGATCCTGCAACTTATTAA


Protein sequences

Name Description Sequence
Vvi.10094 translated coding region predicted by ESTScan from UniGene Vvi.10094

MASTSSFRASSSSTPSIPQTSTYDVFLSFRGADTRYNFTDHLYKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALTEAANLSGWHLQDGYESDNIKKITDDIFRQLNCKRLDVGDNLVGIDFRLKEMDLRLDMESDAVRIVGIYGIGGIGKTTIARVIYNNLSSEFECMSFLENIRGVSNTRGLPHLQNQLLGDILGGEGIQNINCVSHGAIMIKSILSSKRVFIVLDDVDNLVQLEYLLRNRGWLGKGSRVIITTRNKHLLNVQGVDDLYEVDQLNFNEAYELFSLYAFKQNHPKSGFVNLSYSAVSYCQHLPLALKVLGSLLFSKTIPQWESELLKLERVPEAEIHNVLKRSYDGLDRTEKNIFLDIACFFKDEDRDFVLRILDGCNFHAERGIENLIDKSLITLSYNQIRLHDLIQQMGWEIVRENFPNEPDKWSRLWDPHDIERALTTYEGIKGVETINLDLSKLKRVRFNSNVFSKMSRLRLLKVHSNVNLDHDLFYDSEELEEGYSEMYKLEEMLFNRNFVTVRLDKVHSDHDSEDIEEEEEEEDIMASEDYHDYEVAIPCMVGYDFVMETASKMRLGLDFEIPSYELRYLYWDGYPLDSLPSNFDGENLVELHLKCSNIKQLWQGNKYLESLKVIDLSYSTKLIQMPEFSSLSNLERLILKGCVSLIDIHPSIGGLKKLTTLNLKWCLKIKGLPSSISMLESLQLLDLSKCSSFCKFSEIQGNMRCLREPYLKETATKDLPTSIGNSRSFWDLYPCGRSNLEKFLVIQQNMRSLRLLYLCKTAIRELPSSIDLESVEILDLSNCFKFEKFSENGANMKSLRQLVLTNTAIKELPTGIANWESLRTLDLSKCSKFEKFPEIQGNMTSLKKLLLNNTAIKGLPDSIGYLKSLEILNVSDCSKFENFPEKGGNMKSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKFEKFPEKGGNMKSLRVLYLNDTAIKDLPDSIGDLESLEFLDLSDCSKFEKFPEKGGNMKSLKKLSLKNTAIKDLPYSIRDLESLWFLDLSDCSKFEKFPEKGGNMKSLMDLRLKNTAIKDLPNNISGLKFLETLNLGGCSDLWEGLISNQLCNLQKINIPELKCWKLNAVIPESSGILEWIRYHILGSEVTAKLPMNWYEDLDFPGFVVSCVYRDIRTSDDPATY

Domains

Domain Start-End Description Sequence

Seg: seg
3-22 seg

STSSFRASSSSTPSIPQTST

superfamily: SSF52200
IPR000157
11-161 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SSSTPSIPQTSTYDVFLSFRGADTRYNFTDHLYKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALTEAANLSGW

ProfileScan: PS50104
IPR000157
21-158 TIR
Toll-Interleukin receptor

STYDVFLSFRGADTRYNFTDHLYKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALTEAANL

Gene3D: G3DSA:3.40.50.10140
21-150 no description

STYDVFLSFRGADTRYNFTDHLYKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRT

HMMSmart: SM00255
IPR000157
22-158 Toll
Toll/interleukin-1 receptor homology (TIR) domain

TYDVFLSFRGADTRYNFTDHLYKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALTEAANL

HMMPfam: PF01582
IPR000157
25-153 TIR
Toll-Interleukin receptor

VFLSFRGADTRYNFTDHLYKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALT

HMMPanther: PTHR11017:SF20
43-1146 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALTEAANLSGWHLQDGYESDNIKKITDDIFRQLNCKRLDVGDNLVGIDFRLKEMDLRLDMESDAVRIVGIYGIGGIGKTTIARVIYNNLSSEFECMSFLENIRGVSNTRGLPHLQNQLLGDILGGEGIQNINCVSHGAIMIKSILSSKRVFIVLDDVDNLVQLEYLLRNRGWLGKGSRVIITTRNKHLLNVQGVDDLYEVDQLNFNEAYELFSLYAFKQNHPKSGFVNLSYSAVSYCQHLPLALKVLGSLLFSKTIPQWESELLKLERVPEAEIHNVLKRSYDGLDRTEKNIFLDIACFFKDEDRDFVLRILDGCNFHAERGIENLIDKSLITLSYNQIRLHDLIQQMGWEIVRENFPNEPDKWSRLWDPHDIERALTTYEGIKGVETINLDLSKLKRVRFNSNVFSKMSRLRLLKVHSNVNLDHDLFYDSEELEEGYSEMYKLEEMLFNRNFVTVRLDKVHSDHDSEDIEEEEEEEDIMASEDYHDYEVAIPCMVGYDFVMETASKMRLGLDFEIPSYELRYLYWDGYPLDSLPSNFDGENLVELHLKCSNIKQLWQGNKYLESLKVIDLSYSTKLIQMPEFSSLSNLERLILKGCVSLIDIHPSIGGLKKLTTLNLKWCLKIKGLPSSISMLESLQLLDLSKCSSFCKFSEIQGNMRCLREPYLKETATKDLPTSIGNSRSFWDLYPCGRSNLEKFLVIQQNMRSLRLLYLCKTAIRELPSSIDLESVEILDLSNCFKFEKFSENGANMKSLRQLVLTNTAIKELPTGIANWESLRTLDLSKCSKFEKFPEIQGNMTSLKKLLLNNTAIKGLPDSIGYLKSLEILNVSDCSKFENFPEKGGNMKSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKFEKFPEKGGNMKSLRVLYLNDTAIKDLPDSIGDLESLEFLDLSDCSKFEKFPEKGGNMKSLKKLSLKNTAIKDLPYSIRDLESLWFLDLSDCSKFEKFPEKGGNMKSLMDLRLKN

HMMPanther: PTHR11017
43-1146 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YKALDRRGIRTFRDDTLRRGEAIDPELLKAIEGSRSSVIVFSENYAHSRSCLDELVKIMECQKDLGHTVIPIFYHVDPSHVRKQEGSFGAAFAGYEENWKDKIPRWRTALTEAANLSGWHLQDGYESDNIKKITDDIFRQLNCKRLDVGDNLVGIDFRLKEMDLRLDMESDAVRIVGIYGIGGIGKTTIARVIYNNLSSEFECMSFLENIRGVSNTRGLPHLQNQLLGDILGGEGIQNINCVSHGAIMIKSILSSKRVFIVLDDVDNLVQLEYLLRNRGWLGKGSRVIITTRNKHLLNVQGVDDLYEVDQLNFNEAYELFSLYAFKQNHPKSGFVNLSYSAVSYCQHLPLALKVLGSLLFSKTIPQWESELLKLERVPEAEIHNVLKRSYDGLDRTEKNIFLDIACFFKDEDRDFVLRILDGCNFHAERGIENLIDKSLITLSYNQIRLHDLIQQMGWEIVRENFPNEPDKWSRLWDPHDIERALTTYEGIKGVETINLDLSKLKRVRFNSNVFSKMSRLRLLKVHSNVNLDHDLFYDSEELEEGYSEMYKLEEMLFNRNFVTVRLDKVHSDHDSEDIEEEEEEEDIMASEDYHDYEVAIPCMVGYDFVMETASKMRLGLDFEIPSYELRYLYWDGYPLDSLPSNFDGENLVELHLKCSNIKQLWQGNKYLESLKVIDLSYSTKLIQMPEFSSLSNLERLILKGCVSLIDIHPSIGGLKKLTTLNLKWCLKIKGLPSSISMLESLQLLDLSKCSSFCKFSEIQGNMRCLREPYLKETATKDLPTSIGNSRSFWDLYPCGRSNLEKFLVIQQNMRSLRLLYLCKTAIRELPSSIDLESVEILDLSNCFKFEKFSENGANMKSLRQLVLTNTAIKELPTGIANWESLRTLDLSKCSKFEKFPEIQGNMTSLKKLLLNNTAIKGLPDSIGYLKSLEILNVSDCSKFENFPEKGGNMKSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKFEKFPEKGGNMKSLRVLYLNDTAIKDLPDSIGDLESLEFLDLSDCSKFEKFPEKGGNMKSLKKLSLKNTAIKDLPYSIRDLESLWFLDLSDCSKFEKFPEKGGNMKSLMDLRLKN

superfamily: SSF52540
177-424 P-loop containing nucleoside triphosphate hydrolases

DDIFRQLNCKRLDVGDNLVGIDFRLKEMDLRLDMESDAVRIVGIYGIGGIGKTTIARVIYNNLSSEFECMSFLENIRGVSNTRGLPHLQNQLLGDILGGEGIQNINCVSHGAIMIKSILSSKRVFIVLDDVDNLVQLEYLLRNRGWLGKGSRVIITTRNKHLLNVQGVDDLYEVDQLNFNEAYELFSLYAFKQNHPKSGFVNLSYSAVSYCQHLPLALKVLGSLLFSKTIPQWESELLKLERVPEAEI

Gene3D: G3DSA:3.40.50.300
192-340 no description

DNLVGIDFRLKEMDLRLDMESDAVRIVGIYGIGGIGKTTIARVIYNNLSSEFECMSFLENIRGVSNTRGLPHLQNQLLGDILGGEGIQNINCVSHGAIMIKSILSSKRVFIVLDDVDNLVQLEYLLRNRGWLGKGSRVIITTRNKHLLN

HMMPfam: PF00931
IPR002182
207-462 NB-ARC,NBS
NB-ARC

RLDMESDAVRIVGIYGIGGIGKTTIARVIYNNLSSEFECMSFLENIRGVSNTRGLPHLQNQLLGDILGGEGIQNINCVSHGAIMIKSILSSKRVFIVLDDVDNLVQLEYLLRNRGWLGKGSRVIITTRNKHLLNVQGVDDLYEVDQLNFNEAYELFSLYAFKQNHPKSGFVNLSYSAVSYCQHLPLALKVLGSLLFSKTIPQWESELLKLERVPEAEIHNVLKRSYDGLDRTEKNIFLDIACFFKDEDRDFVLRIL

Seg: seg
217-231 seg

IVGIYGIGGIGKTTI

FPrintScan: PR00364
IPR000767
217-232 DISEASERSIST
Disease resistance protein

IVGIYGIGGIGKTTIA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

ILSSKRVFIVLDDVD

FPrintScan: PR00364
IPR000767
387-401 DISEASERSIST
Disease resistance protein

CQHLPLALKVLGSLL

superfamily: SSF52058
490-605 L domain-like,LRR

RLHDLIQQMGWEIVRENFPNEPDKWSRLWDPHDIERALTTYEGIKGVETINLDLSKLKRVRFNSNVFSKMSRLRLLKVHSNVNLDHDLFYDSEELEEGYSEMYKLEEMLFNRNFVT

Seg: seg
612-629 seg

HSDHDSEDIEEEEEEEDI

superfamily: SSF52058
644-830 L domain-like,LRR

CMVGYDFVMETASKMRLGLDFEIPSYELRYLYWDGYPLDSLPSNFDGENLVELHLKCSNIKQLWQGNKYLESLKVIDLSYSTKLIQMPEFSSLSNLERLILKGCVSLIDIHPSIGGLKKLTTLNLKWCLKIKGLPSSISMLESLQLLDLSKCSSFCKFSEIQGNMRCLREPYLKETATKDLPTSIGN

Gene3D: G3DSA:3.80.10.10
663-826 no description

DFEIPSYELRYLYWDGYPLDSLPSNFDGENLVELHLKCSNIKQLWQGNKYLESLKVIDLSYSTKLIQMPEFSSLSNLERLILKGCVSLIDIHPSIGGLKKLTTLNLKWCLKIKGLPSSISMLESLQLLDLSKCSSFCKFSEIQGNMRCLREPYLKETATKDLPT

HMMPfam: PF07725
IPR011713
692-711 LRR_3
Leucine-rich repeat 3

NLVELHLKCSNIKQLWQGNK

Seg: seg
760-773 seg

LKKLTTLNLKWCLK

FPrintScan: PR00364
IPR000767
782-798 DISEASERSIST
Disease resistance protein

SMLESLQLLDLSKCSSF

superfamily: SSF52058
819-1216 L domain-like,LRR

TATKDLPTSIGNSRSFWDLYPCGRSNLEKFLVIQQNMRSLRLLYLCKTAIRELPSSIDLESVEILDLSNCFKFEKFSENGANMKSLRQLVLTNTAIKELPTGIANWESLRTLDLSKCSKFEKFPEIQGNMTSLKKLLLNNTAIKGLPDSIGYLKSLEILNVSDCSKFENFPEKGGNMKSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKFEKFPEKGGNMKSLRVLYLNDTAIKDLPDSIGDLESLEFLDLSDCSKFEKFPEKGGNMKSLKKLSLKNTAIKDLPYSIRDLESLWFLDLSDCSKFEKFPEKGGNMKSLMDLRLKNTAIKDLPNNISGLKFLETLNLGGCSDLWEGLISNQLCNLQKINIPELKCWKLNAVIPESSGILEWIRYHI

Gene3D: G3DSA:3.80.10.10
851-1041 no description

IQQNMRSLRLLYLCKTAIRELPSSIDLESVEILDLSNCFKFEKFSENGANMKSLRQLVLTNTAIKELPTGIANWESLRTLDLSKCSKFEKFPEIQGNMTSLKKLLLNNTAIKGLPDSIGYLKSLEILNVSDCSKFENFPEKGGNMKSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKFEKFPEKGGN

HMMSmart: SM00369
IPR003591
855-878 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MRSLRLLYLCKTAIRELPSSIDLE

HMMSmart: SM00369
IPR003591
901-924 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLRQLVLTNTAIKELPTGIANW

HMMSmart: SM00369
IPR003591
948-971 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTSLKKLLLNNTAIKGLPDSIGYL

HMMSmart: SM00369
IPR003591
995-1018 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLKELSLKNTAIKDLPDSIGDL

HMMPfam: PF12799
996-1032 LRR_4,Leucine Rich repeats (2 copies)

KSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKF

Gene3D: G3DSA:3.80.10.10
1042-1208 no description

MKSLRVLYLNDTAIKDLPDSIGDLESLEFLDLSDCSKFEKFPEKGGNMKSLKKLSLKNTAIKDLPYSIRDLESLWFLDLSDCSKFEKFPEKGGNMKSLMDLRLKNTAIKDLPNNISGLKFLETLNLGGCSDLWEGLISNQLCNLQKINIPELKCWKLNAVIPESSGI

HMMSmart: SM00369
IPR003591
1042-1065 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLRVLYLNDTAIKDLPDSIGDL

HMMPfam: PF12799
1043-1076 LRR_4,Leucine Rich repeats (2 copies)

KSLRVLYLNDTAIKDLPDSIGDLESLEFLDLSDC

Seg: seg
1064-1075 seg

DLESLEFLDLSD

HMMSmart: SM00369
IPR003591
1089-1112 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLKKLSLKNTAIKDLPYSIRDL

Seg: seg
1090-1098 seg

KSLKKLSLK

HMMSmart: SM00369
IPR003591
1136-1159 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLMDLRLKNTAIKDLPNNISGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox