PRGDB00078758 (Vvi.10433)

From PRG Wiki
Jump to: navigation, search
Vvi.10433
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225466024 (XM_002266937)
Gene Class CN
Domain Type NBS, Ser-Thr Kinase
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100242290 (LOC100242290), mRNA

DNA Sequence

ATGGTGTTGTTTTAAGGTTGAAGATTGATGGGTGTTCTTGATTTTCACATGGGTTTGCAGTTGTAAACACTTGAGTTCCCTCTTCATTTTAGAGAGAACTCCTTTGTAGATTGAGCTATTTGAGTCATGGAGGCTAAAGAAATTATTGAAGAAAAACAAGAACTTGCATTGGCGCTTCCCTTACCTTCCACCATTGCAGTGGCTATCAATGGAAAGAAAAAAAGCAAATATGTTGTTAGGTGGGCATTAGAGAAGTTTGTTCCCGAGGGATTGCATATGTTCAAGATGTTACATGTCCGTCCGAAGATAACCTCAGTCCCTACGCCGATGGGAAATTCGATTCCTCTTTCACAAGTGCGAGATGATGTAGCAGCTGCTTACCTGGAAGAAATGGGATGGCAGACAAGTGAAATGCTTCTTCCTTACAAGACAATGTTTTTGCATAAAAAGGTGCAAGTGGATGTTGTTGTGATTGAATCAGATGATGTTGCAAAGGCAATAGCAGAGGAGATAGCAAAAAGCACTATCCATAAGCTTGTTATTGGGGCTTCATCTAGTGGCATGTTTTCAAGGAAAGTTAAGGGACAAAGTCTGTCTTTGAGAATCTCAGAATGCACTCCAAGCTTCTGTACAGTCTATACTGTTTCAAAAGGACAATTATCCTCTGTGCGCCCGTCGGATTCAGATAAAAATGGAAGCATTAAAGAGGACAGTAGTGATGCAAGTTCTACCACCAGTTCTTCAAGTCACACTTCCAGCCCACATGCAGGTTCTGCAGCTTCATATTCTCATTTTCATTCTCCTTCACTACCAATGCAACGCTTTCAAGCTCTTTCAACTATTAACCGGACCCTTCTCCATACAAGAACAGGTTCAATTGAAACCAACTCTTCTAGACGTCAATCTCTGGATATCAGGGAAGAGGAGAGTTTTATGAGTCCATGCCCCAGTAATTCAGATATTGGTTATGCACCTAGTCAGGTTTCTAGTGCTAGAAGCTTCTTGACAGACGATCAATCATGGATTTCTGATCAAGCTTCCACCTCAGATGCTTTTACAGAGTCCTCGTCAGGAAGTCAGCTTCACTTGTACGTGCAGGTGAATATAAATTTTGAGCTAGAAAAACTGAGAGTTGAACTTAGACATGTCCGAGGGATATATGCAATGGCTCAAAGTGAGAACATTGATGCTTCTCGGAAGCTAAACGATCTAAGCAAGCGCCGATTGGAGGAAGCAGATAAGCTTAAGGAAATTAAACTCAAGGAGGAGGAAGCCAGAGAATTAGCAAGAAAAGAGAAGGAGAAATATGAAGCTGCAAAAAGGGAAGCCGAGTACGCAAGGGAATGTGCTGAAAAAGAAGCGTTACAAAGGAAAGAAGCAGAGATCAAAGCCTTGCATGATGTCAAAGAGAAAGAAAAGCTTGAAAATGCACTTGTTGGTCCAGTGCAGTCATATCAGGAGTTCACATGGGAAGAAATTGTGTCTGCTACCTCATCATTCTCTGAAAACCTTCAGATTGGGAAGGGGGCGCATGGAACTGTCTACAGGTGCAATCTGCATCATACAACTGCAGCAGTGAAAGTTCTCCACTCAAAGGAGGGTCATAGAACCAAGGAATTCCAGCAGGAGCTTGATGTATTAAGTAAAATTCGTCATCCTCATCTGCTGCTTCTTCTAGGCGCCTGTTCTGATCATGGTTGCCTAGTGTATGAGTACATGGAAAATGGTAGCTTGGAAGAGAGGTTGCTGCAGAAATATAATACAGCCCCAATTCCATGGTTTGAGAGATACCGAATTGCTTGGGAAGTAGCCTCAACCCTTGTCTTTCTTCACAACTCAAAGCCTAAATCAATCATCCATCGTGATCTGAAACCAGCAAACATCTTGCTTGATCATAACTTGGTGAGCAAGATCGGTGATGTTGGCCTTTCAACAATGCTTAATCTGGACTCTTCTATATGCAACATAAACACAGGTCCTGTTGGAACACTTTGCTACATAGATCCTGAATATCAACGGACTGGTTTAGTCTCTCCAAAATCCGATGTTTATGCTTTTGGGATGGTGGTTTTGCAGTTGCTGACTGCAAAACCAGCAATAGCACTAGCCCACCTGGTGGAAACAGCAATTCAAGATGACCAACTAATGAAGATTTTGGACCCAATGGCTGGGCAATGGCCAATGAAAGAAACAAAAGAATTGGCTCTATTAGGATTAAGCTGTCTAGAGCTTCGCCGAAGAGACAGGCCCGATTTAAAAGATGAGGTACTCCCTGCACTGGAGCGATTAAAAGATGCTGCTGACAGGTCCCGAGATTCAGCTCCCAAGGTTCAGTTGGCACCTCCTAACCATTTTGTCTGCCCAATACTTAAGGATGTAATGCATGACCCTTGTGTTGCTGCGGATGGATACACCTATGACCGAAGAGCAATAGAGAAATGGGTGGAAGAGAATGACAACTCGCCCATGACAAATTTGGCTTTGCCAAATAAGAATCTAATACCCAATTACACACTTCTTTCTGCAATTATGGAATGGAAGTCCCAAAGCAACCAATAATTTTTGGAAGTTTTAGAGTCTGTTGAAGTGATTCTAGGAAGCACTTTTAGCTTTAAAAAGTGTTTttaaaaaaaggtcagatatctgacaaaatttaggaaacacttttaaaaatttgaaaaattaTTATTAGTGTTAGAAATCACTTGCAATGTTTTGTAGAAAAACATTTAATAAGTGGTTGTTTTGGAAACACTTATAGAGAAAATATTTCCAT


Protein sequences

Name Description Sequence
Vvi.10433 translated coding region predicted by ESTScan from UniGene Vvi.10433

MEAKEIIEEKQELALALPLPSTIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQTSEMLLPYKTMFLHKKVQVDVVVIESDDVAKAIAEEIAKSTIHKLVIGASSSGMFSRKVKGQSLSLRISECTPSFCTVYTVSKGQLSSVRPSDSDKNGSIKEDSSDASSTTSSSSHTSSPHAGSAASYSHFHSPSLPMQRFQALSTINRTLLHTRTGSIETNSSRRQSLDIREEESFMSPCPSNSDIGYAPSQVSSARSFLTDDQSWISDQASTSDAFTESSSGSQLHLYVQVNINFELEKLRVELRHVRGIYAMAQSENIDASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKEKYEAAKREAEYARECAEKEALQRKEAEIKALHDVKEKEKLENALVGPVQSYQEFTWEEIVSATSSFSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKVQLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNYTLLSAIMEWKSQSNQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF447
15-784 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LALPLPSTIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQTSEMLLPYKTMFLHKKVQVDVVVIESDDVAKAIAEEIAKSTIHKLVIGASSSGMFSRKVKGQSLSLRISECTPSFCTVYTVSKGQLSSVRPSDSDKNGSIKEDSSDASSTTSSSSHTSSPHAGSAASYSHFHSPSLPMQRFQALSTINRTLLHTRTGSIETNSSRRQSLDIREEESFMSPCPSNSDIGYAPSQVSSARSFLTDDQSWISDQASTSDAFTESSSGSQLHLYVQVNINFELEKLRVELRHVRGIYAMAQSENIDASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKEKYEAAKREAEYARECAEKEALQRKEAEIKALHDVKEKEKLENALVGPVQSYQEFTWEEIVSATSSFSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKVQLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNL

HMMPanther: PTHR24420
15-784 FAMILY NOT NAMED,FAMILY NOT NAMED

LALPLPSTIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQTSEMLLPYKTMFLHKKVQVDVVVIESDDVAKAIAEEIAKSTIHKLVIGASSSGMFSRKVKGQSLSLRISECTPSFCTVYTVSKGQLSSVRPSDSDKNGSIKEDSSDASSTTSSSSHTSSPHAGSAASYSHFHSPSLPMQRFQALSTINRTLLHTRTGSIETNSSRRQSLDIREEESFMSPCPSNSDIGYAPSQVSSARSFLTDDQSWISDQASTSDAFTESSSGSQLHLYVQVNINFELEKLRVELRHVRGIYAMAQSENIDASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKEKYEAAKREAEYARECAEKEALQRKEAEIKALHDVKEKEKLENALVGPVQSYQEFTWEEIVSATSSFSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKVQLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNL

superfamily: SSF52402
20-153 Adenine nucleotide alpha hydrolases-like

PSTIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQTSEMLLPYKTMFLHKKVQVDVVVIESDDVAKAIAEEIAKSTIHKLVIGASSSGMFSRKVKG

Gene3D: G3DSA:3.40.50.620
IPR014729
21-153 no description
Rossmann-like alpha/beta/alpha sandwich fold

STIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQTSEMLLPYKTMFLHKKVQVDVVVIESDDVAKAIAEEIAKSTIHKLVIGASSSGMFSRKVKG

HMMPfam: PF00582
IPR006016
22-151 Usp
UspA

TIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQTSEMLLPYKTMFLHKKVQVDVVVIESDDVAKAIAEEIAKSTIHKLVIGASSSGMFSRKV

Seg: seg
195-219 seg

DSSDASSTTSSSSHTSSPHAGSAAS

Coil: coil
345-412 coiled-coil

YAMAQSENIDASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKEKYEAAKREAEYARECAEKEA

Seg: seg
367-412 seg

LEEADKLKEIKLKEEEARELARKEKEKYEAAKREAEYARECAEKEA

Coil: coil
413-434 coiled-coil

LQRKEAEIKALHDVKEKEKLEN

superfamily: SSF56112
IPR011009
430-741 Protein kinase-like (PK-like)
Protein kinase-like domain

EKLENALVGPVQSYQEFTWEEIVSATSSFSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKVQLAPPN

Gene3D: G3DSA:3.30.200.20
441-517 no description

QSYQEFTWEEIVSATSSFSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLL

ProfileScan: PS50011
IPR000719
458-718 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPAL

HMMSmart: SM00220
IPR002290
458-718 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPAL

HMMSmart: SM00219
IPR020635
458-721 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSENLQIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERL

HMMPfam: PF07714
IPR001245
463-712 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

QIGKGAHGTVYRCNLHHTTAAVKVLHSKEGHRTKEFQQELDVLSKIRHPHLLLLLGACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKD

PatternScan: PS00107
IPR017441
464-485 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGAHGTVYRCNLHHTTAAVK

Gene3D: G3DSA:1.10.510.10
518-712 no description

GACSDHGCLVYEYMENGSLEERLLQKYNTAPIPWFERYRIAWEVASTLVFLHNSKPKSIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDSSICNINTGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMKILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKD

PatternScan: PS00108
IPR008271
576-588 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPANILL

Seg: seg
692-705 seg

LALLGLSCLELRRR

superfamily: SSF57850
721-809 RING/U-box,NBS

LKDAADRSRDSAPKVQLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNYTLLSAIMEWKSQSN

HMMPfam: PF04564
IPR003613
740-808 U-box
U box domain

PNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNYTLLSAIMEWKSQS

Gene3D: G3DSA:3.30.40.10
IPR013083
740-797 no description
Zinc finger, RING/FYVE/PHD-type

PNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNYTL

HMMSmart: SM00504
IPR003613
742-804 Modified RING finger domain
U box domain

HFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNYTLLSAIMEW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox