PRGDB00078789 (Vvi.11965)

From PRG Wiki
Jump to: navigation, search
Vvi.11965
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225439923 (XM_002275324)
Gene Class Mlo-like
Domain Type MLO
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera MLO10 protein (MLO10), mRNA

DNA Sequence

ATGGCGACTGGAAACAACTCCGTTCGCTCTCTGGAACACACCCCGACGTGGGCATTGGCGGTTGTCTGCTTCTTCTTCATAGCCATTTCCATTGTTCTTGAGCACTGTATCCATCTTCTCACCAACTGGCTTAAGAGACATCGGAAGACTGCGTTGTGCGATGCCGTGGACAGACTCAAATCCGAGCTGATGCTTCTGGGGTTCATGTCTCTACTACTAGCAGTAACTCAAGAGCCTATTTCCAAAATCTGCATACCACCCAAGTATGCTGACAAGATGCTTCCCTGTCGGCGACTGGTTGAAGATCAAAGTGCAAATACTACTGATCCTTGCACGTCTAAGGGTATGGTTTCTATAGTGACCCAAAAAGGGATCCAGCAGCTTCAAATCTTCATCTTTGTGCTGGCTGTCATGCAAATTGTTTATAGTGTTCTCACCATGGCTTTGGGCAGGCTTAAGATGAGACGTTGGAGTGCTTGGGAGAAAGAAACACAAACAACAGAGTACCTCGTTGCCAACGATCCTAATCGATTCAGATTCACGAGGCAAACAACTTTCGGAAGACGGCACATGTCTTCTTGTACAGAAACATCCCTTCAATTGTGGACAAAATGCTTCTTCAGACAGTTCTTTCGATCAGTGGTAAAGGTGGACTATATCACTCTGAGGCATGGTTTCATCTCGGCTCATTTGGCACCCAATAGCAACTTCAATTTCCAAAAGTACATACGACGATCACTGGACGAGGATTTCAAGGTCGTAGTCAGCATCAGCCCTCTGATGCGGTTTATTGTGGTTATCTTCTTGCTCCTAGACGTACATGGTTGGCATGTGTATCTCTGGGTGTCCTGCGTTCCTCTTTTGATAGTGCTGATTCTGGGAACCAAACTGGAAGTCATTGTGGAGAGAATGGCCCTTCAGCTAAAACATCAGAACTATGTAATCAAAGGAACTCCTCTGGTTAAGCCCAATGACAATCTCTTCTGGTTTGAGGACCCAAGATTTGTTCTGACTCTTATTCATTACACTCTTTTTACGAATGCATTCGAGCTGGCCTTCTTTATCTGGGTTTCAATAGAATTTGGGTGGGACTCTTGTTACCATGAGCACACGGTGATCACTGCCATAAGAGTGGCGTTGGCTGTGACAGTTCAAGTCCTTTGCAGCTATATTACACTTCCCCTGTATGCACTAGTGACACAGATGGGATCACAATACAAGGGTAAGGCACTGGAAGAGCAGACGGCCAAAATCATAAAGCAGTGGCACGCGGAGGTAAGGGAAAGGAGGAAGAGGCAAGAACAGTCGTTACAATCTCCTCGGACATCTTGGACGACAGAATGGAGCCCAGGAGGAGTAGTGTGACTGAATCTTCATCGCTTCTACGACAATGTAGGCTAGGAGGAAGCCCTACTAGCAAAGGAGAAATCGTGGAGGTGGAAGAAGAAGAAAGTGTAAGAAACGAGGCTGCCTGGTCAAGGTTTCGGTCTATGGCACCCATGCTAGAATTGCCAGCAGTGAAGCGAGATGGGAGATGGAAAGAAAGAGAGTAGGAGGAATGGCAGGGAGGTGAGGTTTGTTTGGGATTGGGCAAAAGCGAGCTCATGGCTAAAGCAAGGCATATGCGTGGCTTGGGCGCATCATGGTATTGGGCGTGTTTCTTGGAAATCCATGTACAACAAGGGCAGTGAGTCAAGCCGTGGCTGGGTTTCTCTCTATATCTTTACAAATATGTGTGCATCCATGAATGACATCCATAAACTGTAATAATTATATACACACTATTATTTGATCCTATATATATTAAGACAAAACAAGAACTGATGGTGATG


Protein sequences

Name Description Sequence
Vvi.11965 translated coding region predicted by ESTScan from UniGene Vvi.11965

MATGNNSVRSLEHTPTWALAVVCFFFIAISIVLEHCIHLLTNWLKRHRKTALCDAVDRLKSELMLLGFMSLLLAVTQEPISKICIPPKYADKMLPCRRLVEDQSANTTDPCTSKGMVSIVTQKGIQQLQIFIFVLAVMQIVYSVLTMALGRLKMRRWSAWEKETQTTEYLVANDPNRFRFTRQTTFGRRHMSSCTETSLQLWTKCFFRQFFRSVVKVDYITLRHGFISAHLAPNSNFNFQKYIRRSLDEDFKVVVSISPLMRFIVVIFLLLDVHGWHVYLWVSCVPLLIVLILGTKLEVIVERMALQLKHQNYVIKGTPLVKPNDNLFWFEDPRFVLTLIHYTLFTNAFELAFFIWVSIEFGWDSCYHEHTVITAIRVALAVTVQVLCSYITLPLYALVTQMGSQYKGKALEEXDGQNHKAVARGGKGKEEEARTVVTISSDILDDRMEPRRSSVTESSSLLRQCRLGGSPTSKGEIVEVEEEESVRNEAAWSRFRSMAPMLELPAVKEMGDGKKESRRNGREVRFVWDWAKASSWLKQGICVAWAHHGIGRVSWKSMYNKGSESSRGWVSLYIFTNMCASMNDIHKL

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
8-456 Mlo
Mlo-related protein

VRSLEHTPTWALAVVCFFFIAISIVLEHCIHLLTNWLKRHRKTALCDAVDRLKSELMLLGFMSLLLAVTQEPISKICIPPKYADKMLPCRRLVEDQSANTTDPCTSKGMVSIVTQKGIQQLQIFIFVLAVMQIVYSVLTMALGRLKMRRWSAWEKETQTTEYLVANDPNRFRFTRQTTFGRRHMSSCTETSLQLWTKCFFRQFFRSVVKVDYITLRHGFISAHLAPNSNFNFQKYIRRSLDEDFKVVVSISPLMRFIVVIFLLLDVHGWHVYLWVSCVPLLIVLILGTKLEVIVERMALQLKHQNYVIKGTPLVKPNDNLFWFEDPRFVLTLIHYTLFTNAFELAFFIWVSIEFGWDSCYHEHTVITAIRVALAVTVQVLCSYITLPLYALVTQMGSQYKGKALEEXDGQNHKAVARGGKGKEEEARTVVTISSDILDDRMEPRRSSVT

Seg: seg
63-73 seg

LMLLGFMSLLL

Seg: seg
177-189 seg

RFRFTRQTTFGRR

Seg: seg
476-489 seg

EIVEVEEEESVRNE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox