PRGDB00078824 (Vvi.14456)

From PRG Wiki
Jump to: navigation, search
Vvi.14456
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225448048 (XM_002273011)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100261701 (LOC100261701), mRNA

DNA Sequence

ATGGCTTCTTCTTCAACCAGTCTCTCAGTAGCATCTTCCTCTTCCACCCATCCACGAAAGTATGAGGTCTTCCTCAGTTTCAGAGGAGAAGACACCCGCAAAAGCTTTACTGATCATCTTCACGAGGCGCTTCATCGATGTGGAATCAACACTTTCATAGATGACCAACTCAGGAGAGGCGAACAAATATCTTCAGCACTCCTACAGGCAATTGAAGAATCAAGGTTTTCCATCATCATTTTCTCCGAACACTATGCTTCTTCAAGTTGGTGTTTGGATGAACTTACAAAGATTCTTGAGTGTGTCAAAGTGGGGGGACATACAGTTTTTCCGGTTTTCTATAATGTGGATCCCTCTCATGTAAGAAAACAAACAGGGAGTTATGGAGTAGCATTTACAAAGCATGAAAAAGTTTACAGGGACAACATGGAGAAAGTGCTCAAGTGGAGAGAAGCTCTAACTGTGGCATCCGGACTTTCTGGATGGGATTCACGAGATAGACATGAATCCAAGGTTATTAAGGAAATTGTTTCAAAGATCTGGAATGAACTGAACGATGCATCCTCATGTAACATGGAGGCTCTAGTTGGAATGGATTCTCATATACAGAACATGGTTTCATTATTATGTATTGGGTCAGATGATGTTCGGATGGTAGGAATTTGGGGCATGGCTGGCATAGGTAAGACTACAATTGCTGAGGCTGTTTATCAGAAAATTTGCACTCAATTCGAAGGTTGTTGCTTTCTTTCAAATGTTAGAGaaaaatcacaaaaaaaTGACCCAGCTGTAATACAAATGGAACTCCTTTCACAAGTTTTTTGGGAAGGCAATCTAAATACAAGAATTTTCAATAGAGGAATCAATGCTATaaaaaaaaCACTCCACTCCATGAGAGTCCTTATTGTTCTTGACGATGTGGATCGCCCACAACAATTGGAGGTTTTAGCTGGAAATCATAACTGGTTTGGTCCAGGAAGTCGAATTATCATCACAACTAGAGAAAAGCATTTGCTAGATGAGAAAGTGGAAATATATGAAGTTAAGGAATTAAACAAAGATGAAGCTCGTAGGCTCTTTTATCAGCATGCCTTTAAATATAAACCTCCTGCAGGAGATTTTGTACAACTATGTGACCGTGCCCTAAATTATACAAAGGGCATTCCCTTAGCCCTTAAAATCTTGGGTCGTTTTTTATACAATAGAAGCAAAAAGGAATGGGAGAGTGAATTGGAAAAACTTAGAAGAATTCCAAACAAAGAGATTCAAGATGTGCTGAGAATAAGCTTTGATGGATTAGATGATAATCAAAAGGATATATTTTTCGACATCGCATGCTTCTTTAAAGGGCAAGACAAAGATTACGTCATAAAACTACTGAAAAGTTGTGATTTCTTTCCAGAAATTGGAATACGTAATCTTATAGATAAGTCTCTTGTAACTATTTCATATAATAAGTTGTGCATGCATGATTTGATACAAGAAATGGGATGGGAAATTGTTCGGCAAGAATCTATGAAAGACCCCGGCAAACGCAGCAGGTTGTGGGTTAATGATGATGTCATTGATATGCTAACAACAAATACAGGGACTGAAGCAGTTGAAGGCATGGTCCTTAACTTGTCTACTTTGAAAGAGCTACACTTCAGTGTTAATGTCTTCACGAAGATGAACAAATTAAGAGTGCTCAGATTCTATGATGCACAAATATGGGGAAGTTCTTGGATATGGAGACGCAATGATCGCTATAAAAGTCCATACACTGAATGTAAATTCCATCTTTCTGGGGATTTTAAATTTCTATCCAACCACTTAAGATCTCTCTACTGGGATGGATACCCTTTGAAGTCCCTTCCATCAAATTTTCATCCTGAGAAGCTTCTCGAGTTAAAAATGTGCTTTAGTCAGCTTGAACAACTATGGGAAGGAAACAAGTCATTTCAGAAGTTAAAGTTCATCGAACTTAGCCACTCTCAACATCTAATCAAAGCACCAGACTTCTCTGGAGCTCCAAAGCTCAGGAGAATAATTCTTGAAGGTTGTACAAGTTTAGTCAAGGTTCATCCATCCATTGGAGCTCTCAAGAAGCTTATTTTCCTGAATTTAGAAGGCTGCAAGAACCTCAAGAGTTTCTTGAGCAGCATCCATCTGGAGTCTCTTCAAATTCTTACTCTCTCTGGCTGCTCAAAACTGAAGAAACTTCCAGAGATACAGGAAAATATGGAGAGTTTGAAAGAGCTTTTTCTAGATGACACTGGTCTAAGAGAGCTACCTTCATCAATTGAGCATCTAAATGGGCTTGTTTTGTTGAAGCTGAAAAATTGTAAAAGACTTGCAAGTCTTCCAGAAAGCATTTGTAAGCTGACGTCTCTTCAGACTCTTACTCTCTCTGGTTGTTCAGAACTGAAGAAATTGCCAGATGATATGGGGAGCCTACAATGTTTATTAAAGCTCAAAGCAAATGGAAGTGGTATACAAGAGGTACCCTCCTCTATTACTCTTTTGACAAGGCTTCAAGTATTATCATTAGCAGGATGTAAAggggggggATCTAAGTCAAGGAATCTGGCTTTATCTTTGCGCGCATCACCAACTGATGGATTGCGACTGTCTTCTTTGACGGTTCTACACTCCTTGAAAAAGTTGAATTTAAGTGACCGCAACCTACTGGAAGGAGCACTACCCAGTGATCTTAGCTCCTTATCTTGGTTGGAATGTTTAGATCTGAGTAGAAACAATTTCATCACCGTGCCTACTAGCCTGAGTCGACTTCCTCACCTCAGAAGGCTCATAGTGGAACACTGCAAGAATCTTCAATCATTGCCAGAGCTTCCGTCAAGTATTAAAGAATTATTGGCCAATGATTGCACATCCCTGGAAACTTTTTCATATCCATCAAGTGCATATCCATTGAGGAAGTTCGGAGATTTCAACTTCGAATTTTCTAATTGCTTCCGACTAGTGGGGAATGAGCAGAGTGACACTGTGGAAGCTATCCTACAGGAAATTCGGCTTGTTGCATCGATACAGAAATCCATGGCTCCAAGTGAGCATTCTGCCAGGTATGGTGAAAGTCGGTATGACGCTGTTGTTCCTGGGAGTAGGATTCCAGAGTGGTTCACCCATCAGAGCGAGGGGGATTCAATAACTGTAGAGCTGCCTCCAGGTTGTTATAATACCAATTCGATTGGATTGGCTGCTTGTGCTGTTTTCCACCCAAAATTCAGCATGGGTAAGATCGGCCGTTCTGCATATTTTAGTGTGAATGAATCTGGCGGCTTCTCTCTCGACAACACGACTTCCATGCATTTTTCAAAAGCTGACCACATCTGGTTTGGGTATCGATTAATTTCTGGAGTGGATTTACGCGATCACTTGAAGGTTGCATTTGCTACATCCAAAGTTCCGGGCGAAGTGGTGAAAAAGTGTGGGGTTCGTCTAGTATATGAGCAAGATGAGATGGGGAATGCATCTTTCCTTTCGGCACCATGTGGCCGGGAGAAGGAGATGAATCAAATTCAGAGTCAGGAGACCGACACCGCCGCTTCCTTTTCCAAACTTCCCCCTACTCTTACTCTCTCTGGTTGCACAGAACTGAAGAAATTGCCAGATGAAATGGAGAGCCTACAATGTTTAGTAAAGCTCAAAGCAAATGGAAGTGGTAGACAAGAGGCATCCACCTCTATTACTCTTCTGACAAAGCTTCAAGTATTATCATTAGCAGGATGTAAGGCAGGGGAATCCAACTCAAGGAATCTGGTTTTATCTTTGCGCTCATCACCAACAGAAGGATTGCCACTGCCTTCTTTGTCGGGTCTGTGCTCCTTGAAAATGCTGATGAATAAGTGA


Protein sequences

Name Description Sequence
Vvi.14456 translated coding region predicted by ESTScan from UniGene Vvi.14456

MASSSTSLSVASSSSTHPRKYEVFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREALTVASGLSGWDSRDRHESKVIKEIVSKIWNELNDASSCNMEALVGMDSHIQNMVSLLCIGSDDVRMVGIWGMAGIGKTTIAEAVYQKICTQFEGCCFLSNVREKSQKNDPAVIQMELLSQVFWEGNLNTRIFNRGINAIKKTLHSMRVLIVLDDVDRPQQLEVLAGNHNWFGPGSRIIITTREKHLLDEKVEIYEVKELNKDEARRLFYQHAFKYKPPAGDFVQLCDRALNYTKGIPLALKILGRFLYNRSKKEWESELEKLRRIPNKEIQDVLRISFDGLDDNQKDIFFDIACFFKGQDKDYVIKLLKSCDFFPEIGIRNLIDKSLVTISYNKLCMHDLIQEMGWEIVRQESMKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFLSNHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLIKAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQILTLSGCSKLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLLKLKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSSITLLTRLQVLSLAGCKGGGSKSRNLALSLRASPTDGLRLSSLTVLHSLKKLNLSDRNLLEGALPSDLSSLSWLECLDLSRNNFITVPTSLSRLPHLRRLIVEHCKNLQSLPELPSSIKELLANDCTSLETFSYPSSAYPLRKFGDFNFEFSNCFRLVGNEQSDTVEAILQEIRLVASIQKSMAPSEHSARYGESRYDAVVPGSRIPEWFTHQSEGDSITVELPPGCYNTNSIGLAACAVFHPKFSMGKIGRSAYFSVNESGGFSLDNTTSMHFSKADHIWFGYRLISGVDLRDHLKVAFATSKVPGEVVKKCGVRLVYEQDEMGNASFLSAPCGREKEMNQIQSQETDTAASFSKLPPTLTLSGCTELKKLPDEMESLQCLVKLKANGSGRQEASTSITLLTKLQVLSLAGCKAGESNSRNLVLSLRSSPTEGLPLPSLSGLCSLKMLMNK

Domains

Domain Start-End Description Sequence

Seg: seg
2-16 seg

ASSSTSLSVASSSST

superfamily: SSF52200
IPR000157
9-162 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SVASSSSTHPRKYEVFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREALTVASGLSGW

Gene3D: G3DSA:3.40.50.10140
18-153 no description

PRKYEVFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREAL

ProfileScan: PS50104
IPR000157
19-159 TIR
Toll-Interleukin receptor

RKYEVFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREALTVASGL

HMMSmart: SM00255
IPR000157
20-159 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYEVFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREALTVASGL

HMMPfam: PF01582
IPR000157
23-153 TIR
Toll-Interleukin receptor

VFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREAL

HMMPanther: PTHR11017:SF20
44-1050 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREALTVASGLSGWDSRDRHESKVIKEIVSKIWNELNDASSCNMEALVGMDSHIQNMVSLLCIGSDDVRMVGIWGMAGIGKTTIAEAVYQKICTQFEGCCFLSNVREKSQKNDPAVIQMELLSQVFWEGNLNTRIFNRGINAIKKTLHSMRVLIVLDDVDRPQQLEVLAGNHNWFGPGSRIIITTREKHLLDEKVEIYEVKELNKDEARRLFYQHAFKYKPPAGDFVQLCDRALNYTKGIPLALKILGRFLYNRSKKEWESELEKLRRIPNKEIQDVLRISFDGLDDNQKDIFFDIACFFKGQDKDYVIKLLKSCDFFPEIGIRNLIDKSLVTISYNKLCMHDLIQEMGWEIVRQESMKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFLSNHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLIKAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQILTLSGCSKLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLLKLKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSSITLLTRLQVLSLAGCKGGGSKSRNLALSLRASPTDGLRLSSLTVLHSLKKLNLSDRNLLEGALPSDLSSLSWLECLDLSRNNFITVPTSLSRLPHLRRLIVEHCKNLQSLPELPSSIKELLANDCTSLETFSYPSSAYPLRKFGDFNFEFSNCFRLVGNEQSDTVEAILQEIRLVASIQKSMAPSEHSARYGESRYDAVVPGSRIPEWFTHQSEGDSIT

HMMPanther: PTHR11017
44-1050 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHRCGINTFIDDQLRRGEQISSALLQAIEESRFSIIIFSEHYASSSWCLDELTKILECVKVGGHTVFPVFYNVDPSHVRKQTGSYGVAFTKHEKVYRDNMEKVLKWREALTVASGLSGWDSRDRHESKVIKEIVSKIWNELNDASSCNMEALVGMDSHIQNMVSLLCIGSDDVRMVGIWGMAGIGKTTIAEAVYQKICTQFEGCCFLSNVREKSQKNDPAVIQMELLSQVFWEGNLNTRIFNRGINAIKKTLHSMRVLIVLDDVDRPQQLEVLAGNHNWFGPGSRIIITTREKHLLDEKVEIYEVKELNKDEARRLFYQHAFKYKPPAGDFVQLCDRALNYTKGIPLALKILGRFLYNRSKKEWESELEKLRRIPNKEIQDVLRISFDGLDDNQKDIFFDIACFFKGQDKDYVIKLLKSCDFFPEIGIRNLIDKSLVTISYNKLCMHDLIQEMGWEIVRQESMKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFLSNHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLIKAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQILTLSGCSKLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLLKLKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSSITLLTRLQVLSLAGCKGGGSKSRNLALSLRASPTDGLRLSSLTVLHSLKKLNLSDRNLLEGALPSDLSSLSWLECLDLSRNNFITVPTSLSRLPHLRRLIVEHCKNLQSLPELPSSIKELLANDCTSLETFSYPSSAYPLRKFGDFNFEFSNCFRLVGNEQSDTVEAILQEIRLVASIQKSMAPSEHSARYGESRYDAVVPGSRIPEWFTHQSEGDSIT

Seg: seg
71-83 seg

IEESRFSIIIFSE

superfamily: SSF52540
178-422 P-loop containing nucleoside triphosphate hydrolases

SKIWNELNDASSCNMEALVGMDSHIQNMVSLLCIGSDDVRMVGIWGMAGIGKTTIAEAVYQKICTQFEGCCFLSNVREKSQKNDPAVIQMELLSQVFWEGNLNTRIFNRGINAIKKTLHSMRVLIVLDDVDRPQQLEVLAGNHNWFGPGSRIIITTREKHLLDEKVEIYEVKELNKDEARRLFYQHAFKYKPPAGDFVQLCDRALNYTKGIPLALKILGRFLYNRSKKEWESELEKLRRIPNKEI

Gene3D: G3DSA:3.40.50.300
192-344 no description

MEALVGMDSHIQNMVSLLCIGSDDVRMVGIWGMAGIGKTTIAEAVYQKICTQFEGCCFLSNVREKSQKNDPAVIQMELLSQVFWEGNLNTRIFNRGINAIKKTLHSMRVLIVLDDVDRPQQLEVLAGNHNWFGPGSRIIITTREKHLLDEKVE

HMMPfam: PF00931
IPR002182
199-466 NB-ARC,NBS
NB-ARC

DSHIQNMVSLLCIGSDDVRMVGIWGMAGIGKTTIAEAVYQKICTQFEGCCFLSNVREKSQKNDPAVIQMELLSQVFWEGNLNTRIFNRGINAIKKTLHSMRVLIVLDDVDRPQQLEVLAGNHNWFGPGSRIIITTREKHLLDEKVEIYEVKELNKDEARRLFYQHAFKYKPPAGDFVQLCDRALNYTKGIPLALKILGRFLYNRSKKEWESELEKLRRIPNKEIQDVLRISFDGLDDNQKDIFFDIACFFKGQDKDYVIKLLKSCDFF

FPrintScan: PR00364
IPR000767
218-233 DISEASERSIST
Disease resistance protein

MVGIWGMAGIGKTTIA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

TLHSMRVLIVLDDVD

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

TKGIPLALKILGRFL

Seg: seg
402-416 seg

RSKKEWESELEKLRR

superfamily: SSF52058
488-847 L domain-like,LRR

CMHDLIQEMGWEIVRQESMKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFLSNHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLIKAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQILTLSGCSKLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLLKLKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSSITLLTRLQVLSLAGCK

Gene3D: G3DSA:3.80.10.10
540-857 no description

NLSTLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFLSNHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLIKAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQILTLSGCSKLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLLKLKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSSITLLTRLQVLSLAGCKGGGSKSRNLA

FPrintScan: PR00364
IPR000767
715-731 DISEASERSIST
Disease resistance protein

IHLESLQILTLSGCSKL

HMMSmart: SM00369
IPR003591
741-764 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MESLKELFLDDTGLRELPSSIEHL

superfamily: SSF52058
782-961 L domain-like,LRR

PESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSSITLLTRLQVLSLAGCKGGGSKSRNLALSLRASPTDGLRLSSLTVLHSLKKLNLSDRNLLEGALPSDLSSLSWLECLDLSRNNFITVPTSLSRLPHLRRLIVEHCKNLQSLPELPSSIKELLANDCTSLET

HMMSmart: SM00369
IPR003591
788-812 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLQTLTLSGCSELKKLPDDMGSL

HMMSmart: SM00369
IPR003591
901-924 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSWLECLDLSRNNFITVPTSLSRL

HMMPfam: PF00560
IPR001611
904-924 LRR_1
Leucine-rich repeat

LECLDLSRNNFITVPTSLSRL

superfamily: SSF52058
1190-1279 L domain-like,LRR

TLTLSGCTELKKLPDEMESLQCLVKLKANGSGRQEASTSITLLTKLQVLSLAGCKAGESNSRNLVLSLRSSPTEGLPLPSLSGLCSLKML

Gene3D: G3DSA:3.80.10.10
1190-1277 no description

TLTLSGCTELKKLPDEMESLQCLVKLKANGSGRQEASTSITLLTKLQVLSLAGCKAGESNSRNLVLSLRSSPTEGLPLPSLSGLCSLK

Seg: seg
1248-1276 seg

SNSRNLVLSLRSSPTEGLPLPSLSGLCSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox