PRGDB00078831 (Vvi.14788)

From PRG Wiki
Jump to: navigation, search
Vvi.14788
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225448997 (XM_002271516)
Gene Class CN
Domain Type NBS
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100244471, transcript variant 1 (LOC100244471), mRNA

DNA Sequence

CCCACGGTTTCTTCCCAACCAAACACACTATTTCTGAGCTTCAGCACTTCTTTTCTCTCGACGCTTCAATCGGGTTTCGAAATGAGAAGAGAGAGAGTTGGCGCTTATTGCCCTTCCCCTGCTCCCACATTCGTGGTTCTCATTATACTATTGGTGGGTTCGGTGCAGTTCGTACAGTGCCAGAACGTGGATGACTACAGCGAGTTTGATAATCCCGAGCTTCTTCCGTTGTTCACACAGCTCGTCTATGGTCAGATTTCCAATATGACTACAATGCTGAGTGCGGAGTTTCAGAATCGCTCCAGTTTCTGCGTTAAGGATCCGGACGCTGATTGGAACCAGGCTTTTAATTATTCATTTAATTTGGACTTCTTGGCTTCTTGCATCCAGAAAACTAAAGGAGATATTACCCGGCGATTGTGCACATCTGCAGAAACAAAGTTCTACTTCAGTAATTTCTTTTTGAAATCAGAGAGTAGCAATTATTTGAGACCTAACAAGAATTGTAACTTGACTACGTGGGTTTCTGGCTGTGAGCCTGGATGGGCTTGTAGTGTTGGTCAAAATCAGCAGGTTAACCTTAAAAATTCACAGAACATTCCTACCAGAACTCATGATTGTCAGGCTTGTTGTGAGGGTTTCTTCTGCCCTCGTGGTATCACTTGCATGATACCGTGTCCATTGGGTTCTTACTGCCCACTTGCAAGGGTCAATAAAACGACTGGTGTATGTGAACCATACCTTTATCAACTACCTCCTGGACAGCCAAACCATACCTGTGGTGGAGCAAATATTTGGGCTGATGTTGGTAGTAGTGGTGAGGTTTTCTGTTCAAGTGGATCATATTGTCCTACAACCACCCAAAAAATTCCCTGCAGTGACGGGCATTATTGCAGGATGGGTTCTACATCTGAGAAAAGGTGCTTCAAGTTGGCTTCATGTAATCCAAACACTGCAAATCAAAACATTCATGCATATGGAGCTATGCTTATAGCTGCTTTGAGCACTCTACTGCTCATTATTTATAACTGTTCTGGCCAAGTACTAACAACTCGGGAAAGGAGACAGGCCAAAACCAGGGAAGCAGCAGCAAGAAGTGCAAGGGAGACAACACGAGCACGTGAAAAGTGGAAAGCTGCAAAAGATGCTGCCAAGAGACGTGCAGTTGGATTGCAAGCTCATCTGTCTCGCACATTTTCTCGTAAAAAATATGTCACTAATTCTGAGGAACTTAGGATTTTGGGTCAGGATAAACCTGTGACAGATGATGACATATTATCACCTATGCACATAAGTGCTTCAGGGGCATCTCAGCTTTCATCTGTGGCAGCAAAAGGAAAGGAAAAAGAACCTAGTGAGCTTGCAAAGATGATGCATGTACTTGATGATGACCTTGATAGTTTTGAACGTTTCAATCTGGAGAATGGAGATAAAAATAGTAAAAAGCATATGCCAAAGGGGAAAGAGATACACACACATAGCCAAATTTTTAAGTACGCATATGCTCAACTTGAGAAAGAGAAAGCTCTGCAACAGGAAAACAAGGACCTTACCTTTTCAGGAGTAATTTCAATGGCTACTGATACTAGAATCAAGAAAAGGCCTCTAATTGAGGTTGCTTTCAGGGATCTAACCCTTACTTTGAAAGGGAAAAACAAACATCTTTTGAGGTGTGTCACTGGAAAAATTATGCCTGGACGCATTACTGCTGTCATGGGTCCATCTGGAGCTGGAAAAACAACATTTATTTCTGCTCTGGCTGGAAAGGCGATTGGATGTAGAATGGCTGGTCTGATTCTTATAAATGGAGTGAATGAATCAATCCACTCATACAAGAAAATCATGGGATTTGTGCCACAAGATGACATTGTGCATGGAAATTTGACAGTGGAAGAAAATCTCTGGTTCAGTGCAAGATGCAGACTATCCATGGACTTGCCAAAGGCGGAAAAGGTTCTTGTCATTGAAAGAGTTATTGAGTCCTTGGGGCTACAGGCAGTGCGGGATTCCTTGGTTGGAACAGTTGAGAAGCGAGGAATCTCTGGAGGCCAGCGGAAGCGTGTAAATGTTGGCCTGGAAATGGTGATGGAACCTTCACTTTTGATCTTAGATGAACCCACTTCTGGTTTGGACAGTTCATCTTCTCAGCTACTTCTCAAAGCACTTCGTCGTGAAGCCCTTGAGGGGGTAAACATCTGCATGGTTGTTCACCAACCAAGCTTTGCCTTGTTCAAGATGTTTGAAGATTTAGTACTTCTAGCAAAAGGTGGTCTTACTGTGTATCATGGTCCAGTGAAGAAAGTTGAAGAGTACTTTGCTGGCCTTGGAATCAATGTCCCAGAGCGTGTTAATCCTCCAGACCACTTCATTGACATTTTGGAGGGTCTGGTAAAACCAAGCACAAGCTCAGGTGTGAGTTATAGTGACCTTCCTATCAGATGGATGCTTCATAAAGGATATCCAGTCCCCCCTGATATGCAAGAGAATGCTGCTGGGCTTACTATGCCCTCAATGGGTGTAAATCCAGTTAATGGAACAAATTCTGATGGTGCTGGAACAGAGGATAAGTCTTTTGCTGGAGAATTATGGCAGGATGTGAAGTGTAATGTGGAGCTACATCGGGATAATATTCGACACAACTTCTTGAAGTCAAACGACTTGTCCAATCGGAGAACTCCTGGAGTTTTTCTGCAGTACAAATACTTTCTTGGCAGGGTTGCTAAGCAACGACTAAGAGAAGCTAGAATACAAGTAATAGATTATCTGATCTTATTACTTGCTGGAGCCTGCCTAGGATCAATTGCTAAAGTGAGCGATGAAACCTTTGGAGCACTTGGTTATACTTATACCATCATTGCAGTTTCTCTCCTATGTAAAATTGCGGCTTTGAGATCATTTTCTCTGGAGAAGTTACAGTACTGGAGAGAGAGTGCATCTGGCATTAGCAGTCTGGCTTATTTTCTCTCCAAGGATACAATTGACCTTTTCAATACAATTATCAAGCCTGTGGTGTATCTCTCCATGTTTTATTTCTTCAATAATCCCAGATCTTCTTTCTCTGATAATTACATTGTTCTCATCTGCCTTGTATACTGTGTGACTGGAATTGCCTATATGTTGGCCATCTTCCTTGAACCTGGTCCAGCACAGCTGTGTTCAGTGCTTCTTCCTGTTGTTTTGACTCTTATTGCAACTCGGACTGGAGAGAGTAAAATTTTGAAGAATTTAGCGAACTTTTGTTACCCAAAATGGGCTTTAGAAGCATTTGTGATTGCAAATGCTGAGAGGTACTATGGAGTGTGGCTCATAACTCGCTGTGGTTCGCTTTTGAAAAGTGGCTATAATCTTCACGATTGGGATCTTTGTATATTCATCCTCATCCTCATAGGCATAGTTTGTCGGGCCATAGCTTTCACTGGCATGGTGACTTTCCGAAGGAAGTGAGTTGAAGTAATCATTCTTTTGCCCAATCTGTTGGTTTGAGAAGCTCATTGCACGGCAAATAGCACCAAAACATGTACAAACATTCTTTGTAGGTAGTGGGTTGGAACCCACATGAATGTTGTATTGAAATTGCAACCAAAACATGTTGTATCCTAGAGGATTTTGTGGGCAGTAGTGAAAGTTGGTTGTCTTTTGAGGTTCTGATGTTTTTTCTTCAATCATTATGTATGCAAATTTTATC


Protein sequences

Name Description Sequence
Vvi.14788 translated coding region predicted by ESTScan from UniGene Vvi.14788

PTVSSQPNTLFLSFSTSFLSTLQSGFEMRRERVGAYCPSPAPTFVVLIILLVGSVQFVQCQNVDDYSEFDNPELLPLFTQLVYGQISNMTTMLSAEFQNRSSFCVKDPDADWNQAFNYSFNLDFLASCIQKTKGDITRRLCTSAETKFYFSNFFLKSESSNYLRPNKNCNLTTWVSGCEPGWACSVGQNQQVNLKNSQNIPTRTHDCQACCEGFFCPRGITCMIPCPLGSYCPLARVNKTTGVCEPYLYQLPPGQPNHTCGGANIWADVGSSGEVFCSSGSYCPTTTQKIPCSDGHYCRMGSTSEKRCFKLASCNPNTANQNIHAYGAMLIAALSTLLLIIYNCSGQVLTTRERRQAKTREAAARSARETTRAREKWKAAKDAAKRRAVGLQAHLSRTFSRKKYVTNSEELRILGQDKPVTDDDILSPMHISASGASQLSSVAAKGKEKEPSELAKMMHVLDDDLDSFERFNLENGDKNSKKHMPKGKEIHTHSQIFKYAYAQLEKEKALQQENKDLTFSGVISMATDTRIKKRPLIEVAFRDLTLTLKGKNKHLLRCVTGKIMPGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGGLTVYHGPVKKVEEYFAGLGINVPERVNPPDHFIDILEGLVKPSTSSGVSYSDLPIRWMLHKGYPVPPDMQENAAGLTMPSMGVNPVNGTNSDGAGTEDKSFAGELWQDVKCNVELHRDNIRHNFLKSNDLSNRRTPGVFLQYKYFLGRVAKQRLREARIQVIDYLILLLAGACLGSIAKVSDETFGALGYTYTIIAVSLLCKIAALRSFSLEKLQYWRESASGISSLAYFLSKDTIDLFNTIIKPVVYLSMFYFFNNPRSSFSDNYIVLICLVYCVTGIAYMLAIFLEPGPAQLCSVLLPVVLTLIATRTGESKILKNLANFCYPKWALEAFVIANAERYYGVWLITRCGSLLKSGYNLHDWDLCIFILILIGIVCRAIAFTGMVTFRRK

Domains

Domain Start-End Description Sequence

Seg: seg
9-22 seg

TLFLSFSTSFLSTL

Seg: seg
328-341 seg

AMLIAALSTLLLII

Seg: seg
359-388 seg

TREAAARSARETTRAREKWKAAKDAAKRRA

Coil: coil
367-388 coiled-coil

ARETTRAREKWKAAKDAAKRRA

HMMPanther: PTHR19241:SF19
385-1147 ATP-BINDING CASSETTE TRANSPORTER-RELATED,ATP-BINDING CASSETTE TRANSPORTER-RELATED

KRRAVGLQAHLSRTFSRKKYVTNSEELRILGQDKPVTDDDILSPMHISASGASQLSSVAAKGKEKEPSELAKMMHVLDDDLDSFERFNLENGDKNSKKHMPKGKEIHTHSQIFKYAYAQLEKEKALQQENKDLTFSGVISMATDTRIKKRPLIEVAFRDLTLTLKGKNKHLLRCVTGKIMPGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGGLTVYHGPVKKVEEYFAGLGINVPERVNPPDHFIDILEGLVKPSTSSGVSYSDLPIRWMLHKGYPVPPDMQENAAGLTMPSMGVNPVNGTNSDGAGTEDKSFAGELWQDVKCNVELHRDNIRHNFLKSNDLSNRRTPGVFLQYKYFLGRVAKQRLREARIQVIDYLILLLAGACLGSIAKVSDETFGALGYTYTIIAVSLLCKIAALRSFSLEKLQYWRESASGISSLAYFLSKDTIDLFNTIIKPVVYLSMFYFFNNPRSSFSDNYIVLICLVYCVTGIAYMLAIFLEPGPAQLCSVLLPVVLTLIATRTGESKILKNLANFCYPKWALEAFVIANAERYYGVWLITRCGSLLKSGYNLHDWDLCIFILILIGIVCRAIAFTGMVTFRRK

HMMPanther: PTHR19241
385-1147 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

KRRAVGLQAHLSRTFSRKKYVTNSEELRILGQDKPVTDDDILSPMHISASGASQLSSVAAKGKEKEPSELAKMMHVLDDDLDSFERFNLENGDKNSKKHMPKGKEIHTHSQIFKYAYAQLEKEKALQQENKDLTFSGVISMATDTRIKKRPLIEVAFRDLTLTLKGKNKHLLRCVTGKIMPGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGGLTVYHGPVKKVEEYFAGLGINVPERVNPPDHFIDILEGLVKPSTSSGVSYSDLPIRWMLHKGYPVPPDMQENAAGLTMPSMGVNPVNGTNSDGAGTEDKSFAGELWQDVKCNVELHRDNIRHNFLKSNDLSNRRTPGVFLQYKYFLGRVAKQRLREARIQVIDYLILLLAGACLGSIAKVSDETFGALGYTYTIIAVSLLCKIAALRSFSLEKLQYWRESASGISSLAYFLSKDTIDLFNTIIKPVVYLSMFYFFNNPRSSFSDNYIVLICLVYCVTGIAYMLAIFLEPGPAQLCSVLLPVVLTLIATRTGESKILKNLANFCYPKWALEAFVIANAERYYGVWLITRCGSLLKSGYNLHDWDLCIFILILIGIVCRAIAFTGMVTFRRK

ProfileScan: PS50893
IPR003439
539-781 ABC_TRANSPORTER_2
ABC transporter-like

VAFRDLTLTLKGKNKHLLRCVTGKIMPGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGGLTVYHGPVKKVEEYFAGLGINVPE

Gene3D: G3DSA:3.40.50.300
541-787 no description

FRDLTLTLKGKNKHLLRCVTGKIMPGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGGLTVYHGPVKKVEEYFAGLGINVPERVNPPD

superfamily: SSF52540
546-767 P-loop containing nucleoside triphosphate hydrolases

LTLKGKNKHLLRCVTGKIMPGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGGLTVYHGPVKK

HMMSmart: SM00382
IPR003593
565-757 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGRITAVMGPSGAGKTTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTSGLDSSSSQLLLKALRREALEGVNICMVVHQPSFALFKMFEDLVLLAKGG

HMMPfam: PF00005
IPR003439
580-708 ABC_tran
ABC transporter-like

TTFISALAGKAIGCRMAGLILINGVNESIHSYKKIMGFVPQDDIVHGNLTVEENLWFSARCRLSMDLPKAEKVLVIERVIESLGLQAVRDSLVGTVEKRGISGGQRKRVNVGLEMVMEPSLLILDEPTS

PatternScan: PS00211
IPR017871
680-694 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGQRKRVNVGLEM

Seg: seg
708-728 seg

SGLDSSSSQLLLKALRREALE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox