PRGDB00078859 (Vvi.15683)

From PRG Wiki
Jump to: navigation, search
Vvi.15683
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 193878341 (EU812235)
Gene Class Mlo-like
Domain Type MLO
Gene Species Vitis vinifera

Comment?

Vitis vinifera MLO-like protein 6 (MLO6) mRNA, complete cds

DNA Sequence

ATCACAGTATTGCTTTCTAGAATTTGTGGCAACAGACCCAGGTTGCCAAGTAAGGGGAAGAGAGGATATGGCTGGcgacgaggagacgacgacgacgacgacgGCAGCAACACTTGAAACAACGTCCACTTGGGCTGTTGCCTCTGTTTGCTTCATTTTGATTGCACTCTCCATACTTATTGAGCATGCTCTCCATCTCTTAGCCAAGTACTTCAACAAGAAGCGGAGGAGGTCTCTCATTCATGCTCTTAACAACGTCAAATCGGAGTTGATGCTCTTGGGGTTCGTATCTTTGTTGCTGACTGTGTGCCAAAAGTATATTGCGAAGATTTGTATCCCAAGGAGCGTAGGTGAAACTTTTCTTCCCTGCAAGACCTTGACAGAAAGTGATTCAGAAGAAGAAACCAAATGCGAAGAGCAGGGAAAGATGTCTTTGTTGTCTACACAAGGCGTGGAGGAACTACAGTACTTAATTTTCGTGCTGGCCTTCTTCCATTCGCTCTACTGCGTCCTCACATTCGGTCTTGGGATGGCCAAGATGAAGAAATGGGAGTCCTGGGAGGCAGAAACAAGAACACTGGAATATCAGTTTACAAATGATCCACGGAGGTTCACGCTCATCCATCAGACATCATTTGGAAAGCAACATCTGAGATATTGGAGTGAGCATCGGATACTTCGTTGGCCGGTTTGTTTTATTCAGCAGTTCTATCCATCCGTCTCCAAAGTGGATTACTTGACTCTTAGACATGGGTTCATTATGGCCCATTTTGCAGAAGGAAGCAACTATGACTTCCAAAAGTATATAAAAAGAGCTTTGGAAAAAGACTTTGGAGTGGTGGTGGGAGGAAGTTTCTGGGTTTGGAGTTTCTCCATGCTTTTTGTGTTCTTCAATGCTCAAGTATTTTACAACTATTTATGGCTACCCTTTATTCCATTGGTGATGCTGTTGTTGGTTGGAACAAAGCTACAGGGCATTATAACTAAGATGTGCCTAGATAGCCATGATAAAGCTCTCGTTGTTAGAGGAACTTTGCTTGTCAGGCCCAGTGATCACTTCTTCTGGTTTGGAAAACCGGAATTGCTCCTACATCTTATGCACTTTATATTGTTTCAGAACTCTTTTCAACTGGCGTTCTTTACATGGACTTGGTACAAATTTGGATTCAGATCATGCTTCCATGATACAACTGAGGATATCGTCATAAGGCTTGTCATGGGTGTGTTAGTACAACTCCTTTGTGGCTACGTGACACTGCCTCTGTATGCCCTGGTCACGCAGATGGGGACATCAATGAGGACAATTGTCTTTACTGAGGGAGTCGTTGAAGGTCTGAACAGATGGAGAAGGAAAGCCAAGAAAAACATAGCACGCAGGAACAACCACTCAGCTCGTCCCTCCCTGGATGCTTCACTGGACAATTCACCTTCTTTTAACACTCTGGATACTTCTTTCTCTGTAGACCTCGATCAGCCATCATCAGATGCTGGCTATTTGACTGTTGAAATATCAGATGAAGAGACGGTCGCAACTAAACAGCCAGAACCGCGTCAGAAGTTGGGATGTTTTGAGGGTTTCGACTTGCGCAAAACATCATAATATCTGATTATGAGAGGATTCGATTAAAAGCTATTCTTGACAAGCCATATGCAATGCCCACATCGCTTGTCAGTGATCAATGATGAGGTTGTTGATTCAATTCGAAGCTTAAACAGTACTAAGCTCAACACAAATCAAATGGCATGGTGATCATAGTTCAGTGGTGGCTGAAAGAGAGGTTGTACAGTCATTTCTGCTATTTTTTCATCTCTCTATATATTAGAAGCAGTGTACGTATATATTGATAGATGATATTCATTTACAGAAGAACACAAAAACAATGATGCCTTCTATGTTAATTAAACATACATGATGTGATTTTGTTTTCCaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Vvi.15683 translated coding region predicted by ESTScan from UniGene Vvi.15683

XSQYCFLEFVATDPGCQVRGREDMAGDEETTTTTTAATLETTSTWAVASVCFILIALSILIEHALHLLAKYFNKKRRRSLIHALNNVKSELMLLGFVSLLLTVCQKYIAKICIPRSVGETFLPCKTLTESDSEEETKCEEQGKMSLLSTQGVEELQYLIFVLAFFHSLYCVLTFGLGMAKMKKWESWEAETRTLEYQFTNDPRRFTLIHQTSFGKQHLRYWSEHRILRWPVCFIQQFYPSVSKVDYLTLRHGFIMAHFAEGSNYDFQKYIKRALEKDFGVVVGGSFWVWSFSMLFVFFNAQVFYNYLWLPFIPLVMLLLVGTKLQGIITKMCLDSHDKALVVRGTLLVRPSDHFFWFGKPELLLHLMHFILFQNSFQLAFFTWTWYKFGFRSCFHDTTEDIVIRLVMGVLVQLLCGYVTLPLYALVTQMGTSMRTIVFTEGVVEGLNRWRRKAKKNIARRNNHSARPSLDASLDNSPSFNTLDTSFSVDLDQPSSDAGYLTVEISDEETVATKQPEPRQKLGCFEGFDLRKTS

Domains

Domain Start-End Description Sequence

Seg: seg
28-46 seg

EETTTTTTAATLETTSTWA

HMMPfam: PF03094
IPR004326
37-465 Mlo
Mlo-related protein

ATLETTSTWAVASVCFILIALSILIEHALHLLAKYFNKKRRRSLIHALNNVKSELMLLGFVSLLLTVCQKYIAKICIPRSVGETFLPCKTLTESDSEEETKCEEQGKMSLLSTQGVEELQYLIFVLAFFHSLYCVLTFGLGMAKMKKWESWEAETRTLEYQFTNDPRRFTLIHQTSFGKQHLRYWSEHRILRWPVCFIQQFYPSVSKVDYLTLRHGFIMAHFAEGSNYDFQKYIKRALEKDFGVVVGGSFWVWSFSMLFVFFNAQVFYNYLWLPFIPLVMLLLVGTKLQGIITKMCLDSHDKALVVRGTLLVRPSDHFFWFGKPELLLHLMHFILFQNSFQLAFFTWTWYKFGFRSCFHDTTEDIVIRLVMGVLVQLLCGYVTLPLYALVTQMGTSMRTIVFTEGVVEGLNRWRRKAKKNIARRNNHSA

Seg: seg
128-140 seg

TESDSEEETKCEE

Seg: seg
278-292 seg

FGVVVGGSFWVWSFS

Seg: seg
447-462 seg

NRWRRKAKKNIARRNN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox